current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980    .  990    . 1000    . 1010    . 1020    . 1030    . 1040    . 1050    . 1060    . 1070    . 1080    . 1090    . 1100    . 1110    . 1120    . 1130    . 1140    . 1150    . 1160    . 1170    . 1180    . 1190    . 1200    . 1210    . 1220    . 1230    . 1240    . 1250    . 1260    . 1270    . 1280    . 1290    . 1300    . 1310    . 1320    . 1330    . 1340    . 1350    . 1360    . 1370    . 1380    . 1390    . 1400    . 1410    . 1420    . 1430    . 1440    . 1450    . 1460    . 1470    . 1480    . 1490    . 1500    . 1510    . 1520    . 1530    . 1540    . 1550    . 1560    . 1570    . 1580    . 1590    . 1600    . 1610    . 1620    . 1630    . 1640    . 1650    . 1660    . 1670    . 1680    . 1690    . 1700    . 1710    . 1720    . 1730    . 1740    . 1750    . 1760    . 1770    . 1780    . 1790    . 1800    . 1810    . 1820    . 1830    . 1840    . 1850    . 1860    . 1870    . 1880    . 1890    . 1900    . 1910    . 1920    . 1930    . 1940    . 1950    . 1960    . 1970    . 1980    . 1990
# Score Template Links and tools%idFirst MMKLKEMVEAAEAKVESKPPQAAEEKAPDQAAGGAEEDVAAAPAEGGEGAEPLDQAEIEKMLFDESLGAQEYTYEEFLDLIDQPPEERGEAEDERKHWSYPRRWKVVLWNLQIQNYMDDNFSAFMEFEFGGTREECKVHKGTSVLIYATGQDKNYLRTPVIPDVSNAGPVDMHFRKAFEYRGSYLDLEREKLKIKVWEYRNWTLNHLEAVYEEALLNLATGETHVERDLYKFIKGRRSRRCRISFHLYFQELYDFELSFVKWRLVQIMPCPTLQEKIANRGKNKGGYTREATIGFKRHQLADQAKYVFQQRQVKREMQKRDSQRELLPGASRPEMLGGFADKGSARLSHLGFESAMKMPNRGTRSPSGLESNRPEDGNRNMEEIFLQHQATILASDQLEELPASLRPPLSKRRKGEDKKDGNKADGPQVKMTISLMHASSMNKGLGLVSSERPADGIPRWDNLGEIYFRGTLRDLDSTYIQVVVEDTTAPKVMRQIGYGQIPLRGVVDYSCLSTELGTPMWLALQAKMEGWGHELKEWCFGFVEGTVMVAHLPRYRQLGEVSESDSDRVYLILRIKDVDQIVTPDNRPVVDSYVEVSFDGTSRRTRTVRNTLNPVWDDEVTIPLRLPAFRDITESDVTRKGKVWLDVWGTGPGYVDHLGGCSFSLYEIFFNEKHNKRNLTAMQRIDLEANTRQSYETRVFSTSRRLAFIHKADRPSTIQFEAWTCPDILEVSGIDKLPEPERITTTSNFPRALRNTYERLKRMYAEVIEKKGLVNPDTGVGPPRFFDVEFLDQRKETHYAPTMVTRIRPPFGVDSESSVFHYCRCVPFAVKRENLVFTPEFAVQIRSGNAMDHSILMTSLLLGLPAFAFVCVGTLWDKHMHAWVATFHYDDDRACGVVKFWETTTGLVYTLKHRFRDPYTLQRLSADPEFGILKMMNIQRRKRLSILGVSVDADTPDYISRSGEDLVQSEFPTGGAKLPYRSLDIMFNNRNVWLNIQDGNPAKVWFDIWDVVSRSGETVPLQAFLASSQTRLGRKETIASLLQLKLSPFDTLRQSCCDVRHPRREDRNAAKHCSFPRVFARLQSPRTRALAEQWYQFSPGLHDVPPCFIVRGFGAKVAEWQFDRAAQEIQGKVLSDITAFRATRNLPTKWNRDDVLDAFLQMGLELLHQAATARDEDFQLARLKLEDWKKAFYSKVPCSYRVRGAPLHFNTYDSKTISDAIIANVDFVESRDRSAFFSLAVMLYNLPGELVSTYVYICVTQKVTERERRRILAQKEKQSREDAQRKARKQRRKAGHEGADNGAEDKQGAEGNEEEHGDAAAAAVAEESVSAEAVQGDEEPKKVVKKGAVPRVKKRSYDQVEGTEVAAIAIERDFFTEAEAPDFKNLMSDVEHAINTHLGLSPGRVRAFQARYAEKRIVFAVGPPMDDATEADAVSSVALMEKLRDILPSMAHEEGRFQEVTGGGATLQWDGPGTNILDRIAQEQATAGEGEQQTSEGIPTRDMQVDGTAVLEEAGEKSDKKKKKKEKKEKKEKKEKKEKKEKKEKKKKKGGETAAEPEEASAVLAPPPVPVPAAAIPSVLLPADSEDGEKEQPKEKKKEKKEKKKKKDGETDAEPEEASAVLAPPPVPVPAAAIPSILLPTDGEDGEKEKTKEKKTEKKKEKHTEKKHKKKSEALPESETTAVVTVTPGEEDETSPLVPVPSSIASSEAPEPPASTRVTPAPEPKAKPGLSMGAALLAVRARSRLQRKHLAQQLSSSSSSEVSASSASSLSPSSSSSSDFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENTRLAATRRRDDKLQRQVEAERERAVELLKEATRRAKEEKDLIARQPPPARDWSDTVVLSTPQIFVNSQAACAPFADSGRDEGGRDEWYEVSDACSRRAESSNESRTTAGAKLRQQQLDLAGRTLast
1 -407.000IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali  100  1MMKLKEMVEAAEAKVESKPPQAAEEKAPDQAAGGAEEDVAAAPAEGGEGAEPLDQAEIEKMLFDESLGAQEYTYEEFLDLIDQPPEERGEAEDERKHWSYPRRWKVVLWNLQIQNYMDDNFSAFMEFEFGGTREECKVHKGTSVLIYATGQDKNYLRTPVIPDVSNAGPVDMHFRKAFEYRGSYLDLEREKLKIKVWEYRNWTLNHLEAVYEEALLNLATGETHVERDLYKFIKGRRSRRCRISFHLYFQELYDFELSFVKWRLVQIMPCPTLQEKIANRGKNKGGYTREATIGFKRHQLADQAKYVFQQRQVKREMQKRDSQRELLPGASRPEMLGGFADKGSARLSHLGFESAMKMPNRGTRSPSGLESNRPEDGNRNMEEIFLQHQATILASDQLEELPASLRPPLSKRRKGEDKKDGNKADGPQVKMTISLMHASSMNKGLGLVSSERPADGIPRWDNLGEIYFRGTLRDLDSTYIQVVVEDTTAPKVMRQIGYGQIPLRGVVDYSCLSTELGTPMWLALQAKMEGWGHELKEWCFGFVEGTVMVAHLPRYRQLGEVSESDSDRVYLILRIKDVDQIVTPDNRPVVDSYVEVSFDGTSRRTRTVRNTLNPVWDDEVTIPLRLPAFRDITESDVTRKGKVWLDVWGTGPGYVDHLGGCSFSLYEIFFNEKHNKRNLTAMQRIDLEANTRQSYETRVFSTSRRLAFIHKADRPSTIQFEAWTCPDILEVSGIDKLPEPERITTTSNFPRALRNTYERLKRMYAEVIEKKGLVNPDTGVGPPRFFDVEFLDQRKETHYAPTMVTRIRPPFGVDSESSVFHYCRCVPFAVKRENLVFTPEFAVQIRSGNAMDHSILMTSLLLGLPAFAFVCVGTLWDKHMHAWVATFHYDDDRACGVVKFWETTTGLVYTLKHRFRDPYTLQRLSADPEFGILKMMNIQRRKRLSILGVSVDADTPDYISRSGEDLVQSEFPTGGAKLPYRSLDIMFNNRNVWLNIQDGNPAKVWFDIWDVVSRSGETVPLQAFLASSQTRLGRKETIASLLQLKLSPFDTLRQSCCDVRHPRREDRNAAKHCSFPRVFARLQSPRTRALAEQWYQFSPGLHDVPPCFIVRGFGAKVAEWQFDRAAQEIQGKVLSDITAFRATRNLPTKWNRDDVLDAFLQMGLELLHQAATARDEDFQLARLKLEDWKKAFYSKVPCSYRVRGAPLHFNTYDSKTISDAIIANVDFVESRDRSAFFSLAVMLYNLPGELVSTYVYICVTQKVTERERRRILAQKEKQSREDAQRKARKQRRKAGHEGADNGAEDKQGAEGNEEEHGDAAAAAVAEESVSAEAVQGDEEPKKVVKKGAVPRVKKRSYDQVEGTEVAAIAIERDFFTEAEAPDFKNLMSDVEHAINTHLGLSPGRVRAFQARYAEKRIVFAVGPPMDDATEADAVSSVALMEKLRDILPSMAHEEGRFQEVTGGGATLQWDGPGTNILDRIAQEQATAGEGEQQTSEGIPTRDMQVDGTAVLEEAGEKSDKKKKKKEKKEKKEKKEKKEKKEKKEKKKKKGGETAAEPEEASAVLAPPPVPVPAAAIPSVLLPADSEDGEKEQPKEKKKEKKEKKKKKDGETDAEPEEASAVLAPPPVPVPAAAIPSILLPTDGEDGEKEKTKEKKTEKKKEKHTEKKHKKKSEALPESETTAVVTVTPGEEDETSPLVPVPSSIASSEAPEPPASTRVTPAPEPKAKPGLSMGAALLAVRARSRLQRKHLAQQLSSSSSSEVSASSASSLSPSSSSSSDFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENTRLAATRRRDDKLQRQVEAERERAVELLKEATRRAKEEKDLIARQPPPARDWSDTVVLSTPQIFVNSQAACAPFADSGRDEGGRDEWYEVSDACSRRAESSNESRTTAGAKLRQQQLDLAGRT 1990
2 -47.100IDP92738 gene: hsa; streptococcal hemagglutinin [Streptococcus gordonii] BAA97453 [Streptococcus gordonii]  ali follow..  4.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KRQKGQYHEVERVTRFKLIKSGKHWLRAATSQFGLLRLMKGADISSVEVKVAEEQSVEKGGLNYLKGIIATGAVLGGAVVTSSSVYAEEEQALEKVIDTRDVLATRGEAVLSEEAATTLSSEGANPVESLSDTLSASESASANSVSTSISISESFSVSASASLSSSSSLSQSSSESASASESLSVSASTSQSFSSTTSSTQSSNNESLISSDSSNSLNTNQSVSARNQNARVRTRRAVAANDTEAPQVKSGDYVVYRGESFEYYAEITDNSGQVNRVVIRNVEGGANSTYLSPNWVKYSTENLGRPGNATVQNPLRTRIFGEVPLNEIVNEKSYYTRYIVAWDPSGNATQMVDNANRNGLERFVLTVKSQNEKYDPAESSVTYVNNLSNLSTSEREAVAAAVRAANPNIPPTAKITVSQNGTVTITYPDKSTDTIPANRVVKDLQISKSNSASQSSSVSASQSASTSVSASISASMSASVSVSTSASTSASVSASESASTSASVSASESASTSASVSASKSSSTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESSSTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASESASTSASVSASE....... 715
3 -44.500IDP92737 platelet-binding glycoprotein [Streptococcus sanguinis SK36] YP_001034807 [Streptococcus sanguinis SK36]  ali follow..  10  3......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................FKRQKGKYHEVERVTRFKLIKSGKHWLRAATSQFGLFRSMKGGGLSSIELKVTEEQVTDKKSGIDFLRGIVATGAVLGGAVVTSTTVHAEEGQALEKVIDTTDVLATRGETVLGEESSAAEAATATASSHTESESVSDTSSASASASVSASISASISASESMSQFSSASISASTSQAVSDSLSVSESLSVSSSTSDSVSASQPASTSASSKSESTVNSQSASSETNRSSTNNGSTSSSSETARVRKRRATDTTPPTITVPSDIIAYRGEEFEFYFEITDDSGQVKNIELSTFGKPLGLNWLEYSEDNFNVPGNATSDNPLRVRVHGTVPLNEPIPADKNRAQFTRTIRAWDAAGNVSSNITFVIKYRAQTDKYNPADPTITYVDRLSSLSPSEKNAVEAAVRAANPQIPAAARITVSANGTVTITYPDSSTDTITANRVVKDLASSRSALTSASTSASTSASVSASTSASLSASTSASQSIVDSKSASVSASTSASTSASTSASVSASTSASTSASVSASTSASASASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSAS........ 698
4 -39.900IDP92612 gene: gbs1529; Unknown [Streptococcus agalactiae NEM316] CAD47188 [Streptococcus agalactiae NEM316]  ali follow..  1......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MSQKTFGKQLTVVDTKSRVKMHKSGKNWVRTVMSHFNLFKAIKGRATVEADVCIQDVEKEDRLSSGNLTYLKGILAAGALVGGASLTSRVYADETPVVQEQSSSVPTLAEQTEVTVKTTTVQNHQDGTVSKNIIDSNSVSMSESASTSTSESVSMSMSGSTLTSVSESVSTSALTSASESISTSASESVSKSTSISEVSNILETQASLTDKGRESFSANQIVTESSLVTDAGKNASVSSLIEITKPKSELQTSKMSNESLITPEKSQVMIASDKTGNESLTPTIRLKSVIQPRSMNLMTLSSEMDLIPLEEVSDTEMLGKDVSSELQKVNIALKDNTLSEPGTVKLDSSENLVLNFAFSIASVNEGDVFTVKLSDNLDTQGIGTILKVQDIMDETGQLLATGSYSPLTHNITYTWTRYASTLNNIKARVNMPVWPDQRIISKTTSDKQCFTATLNNQVASIEERVQYNSPSVTEHTNVKTNVRSRIMKLDDERQTETYITQINPEGKEMYFASGLGNLYTIIGSDGTSGSPVNLLNAEVKILKTNSKNLTDSMDQNYDSPEFEDVTSQYSYTNDGSKITIDWKTNSISSTTSYVVLVKIPKQSGVLYSTVSDINQTYGSKYSYGHTNISGDSDANAEIKLLSESASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSA....... 713
5 -38.500IDP92610 gene: srr-2; serine-rich repeat protein [Streptococcus agalactiae] AAZ95526 [Streptococcus agalactiae]  ali follow..  406.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KMTYISQINVDGKSLYNYNGLYTRIYNYSKESTADLKNSTIKIYKTTSDNIVESMVQDYSSMEDVTSKFANSYPEKGWYDIYWGQFIASNETYVIVVETPFTNAVTLNTTLSDYNENNGVEHNHTYSSESGYSDVNAQERKILSELVSSSESVSSSESVSNSESISTSESVSNSESISSSESVSSSES--STSESVSTSESISSSESVSSSESVSSSESISSSESVSNSESISSSESVSNSESISSSESVSSSESISNSESISSSESVSTSESISSSESVSNSESISSSESVSSSESISNSESISSSESVSTSESISNSESVSSSESVSTSESISSSESVSNSESISTSESVSTSESISSSESVSSSESISSSESVSNSESISNSESVSSSESVSNSESISSSESVSNSESISTSESVSTSESISSSESVSNSESISSSESVSNSESISSSESVSNSESISSSESVSNSESISSSESVSSSESVSSSESISTSESVSNSESISSSESVSNSESISSSESVSNSESISSSESVSNSESISSSESVSSSESISSSESVSSSESVSNSESISSSESVSNSESISSSESVSSSESISSSESVSNSESILSSESVSSSESISSSESISSSESVSMSTTESLSESEVSGDSEISSSTESSSQSESMNHTEIKSDSESQHEVKHQVLPETGDNSAS-ALGLLGAGLLLGATKSRKKKKD..... 1115
6 -38.400IDP92613 RecName: Full=Serine-rich adhesin for platelets; AltName: Full=Staphylococcus aureus surface protein A; Flags: Precursor SAOUHSC_02990 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  558.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................VKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTTAPTVTPIGDQSSEVYSPISPIKIATQDNSGNAVTNTVTGLPSGLTFDSTNNTISGTPTNIGTSTISIVSTDASGNKTTTTFKYEVTRNSMSDSVSTSGSTQQSQSVSTSKADSQSASTSTSGSIVVSTSASTSKSTSVSLSDSVSASKSLSTSESNSVSSSTSTSLVNSQSVSSSMSDSASKSTSLSDSISNSSSTEKSESLSTSTSDSLRTSTSLSDSLSMSTSGSLSKSQSLSTSISGSSSTSASLSDSTSNAISTSTSLSESASTSDSISISNSIANSQSASTSKSDSQSTSISLSTSDSKSMSTSESLSDSTSTSGSVSGSLSIAASQSVSTSTSDSMSTSEIVSDSISTSGSLSASDSKSMSVSSSMSTSQSGSTSESLSDSQSTSDSDSKSLSQSTSQSGSTSTSTSTSASVRTSESQSTSGSMSASQSDSMSISTSFSDSTSDSKSASTASSESISQSASTSTSGSVSTSTSLSTSNSERTSTSMSDSTSLSTSESDSISESTSTSDSISEAISASESTFISLSESNSTSDSESQSASAFLSESLSESTSESTSESVSSSTSESTSLSDSTSESGSTSTSLSNSTSGSTSISTSTSI....... 1267
7 -36.300IDP06537 Surface protein from Gram-positive cocci, anchor region [Enterococcus faecium DO] EAN08832 [Enterococcus faecium DO]  ali follow..  100.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................QKTDSFANSSGIPTGSTRMNKFVVGSNVDVALQDGHPTVNGSRLDHLTPDDFYKDRAGHEYIDFEQEFAKLNVAANDLATITPAKTYTAADFPDMNNRTIDLTDLSDTGFLLVNIDAEVLTMNTPLQIINPNDQVVVFNVINSSSALNVQSPIKYNDRSNHETEDFSDANISWNFGNEMTDLTISAPFQGTILAPNATIRITQNQDGTIIGTNVILDAATNRWDPNEIFISDNGTDTTDTSDSTDTSTTSDSSDSSTSSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTSTTTSDSTDTSASSDSTDTTSTTSDSSDSSTTTSDSTDTSASSDSTDTSSTTSDSSDSSTSSDSTDTSSTTSDTRHASVSFSKTSSDNRTNFNLTNKTSNDNGNKSKRALPKTGSQSNNWITLAGVILLVIGLRITFMSYKKSK..... 659
8 -33.900IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  334........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ISGTGSTVSTNAKPNEVVSSLGSLSSNPSSLTTSKELSSASDGYIFNPKDIVEETATAYIVRHGDHFHKSNQIGQPTLPNNSLATPSPSLPINPGTSHEKHEEDGYGFDANRIIAEDKKDLTEEQIKAAQKHLEEVKTSHNGLDSLSSHEQDYPSNAKEMKDLDKKIEEKIAGIMKQYGVKRESIVVNKEKNAIIYPHGD-KPVGIGHSHSNYELFKPEEGVAKKEGNKVYTGEELTNVVNLLKNSTFNNQNFTLANGQKRVSFSFPPELEKKLGINMLVKLITPDGKVLEKVSGKVFGEGVGNIANFELDQPYLPGQTFKYTIASKDYPEVSYDGTFTVPTSLAYKMASQTIFYPFHAGDTYLRVNPQFAVPKGTDALVRVFDEFHGNAYLENNYKVGEIKLPIPKLNQGTTRTAGNKIPVTFMANAYLDNQSTYIVEVPILEKENQTDKPSILPQFKRNKAQENSKLDEKVEEPKTSEKVEKEKLSETGNSTSNSTLEEVPTVDPVQEKVAKFAESYGMKLENV-LFNMDGTIELYLPSGEVIKKNMADFTGEAPQGNGENKPSENGKVSTGTVENQP-------TENKPADSLPEAPNEKPVKPENSTDNGMLNPEGNVGSDPMLDPALEEA----------PAVDPVQEKLEKFTASYGLGL--------------------DSVIFNMDGTIELRLPSGEVIKKNLSDLIA.. 1039
9 -32.700IDP06528 gene: scm; collagen-binding MSCRAMM Scm (Fms10) [Enterococcus faecium DO] AFK60297 [Enterococcus faecium DO]  ali follow..  125..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SNVDVALQDGHPTVNGSRLDHLTPDDFYKDRAGHEYIDFEQEFAKLNVAANDLATITPAKTYTAADFPDMNNRTIDLTDLSDTGFLLVNIDAEVLTMNTPLQIINPNDQVVVFNVINSSSALNVQSPIKYNDRSNHETEDFSDANISWNFGNEMTDLTISAPFQGTILAPNATIRITQNQDGTIIGTNVILDAATNRWDPNEIFISDNGTDTTDTSDSTDTSTTSDSSDSSTSSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTSTTTSDSTDTSASSDSTDTTSTTSDSSDSSTTTSDSTDTSASSDSTDTSSTTSDSSDSSTSSDSTDTSSTTSDTRHASVSFSKTSSDNRTNFNLTNKTSNDNGNKSKRALPKTGSQSNNWITLAGVILLVIGLRITFMSYKKSKR......... 603
10 -32.600IDP05238 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo1799 [Listeria monocytogenes EGD-e]  ali follow..  192.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ANDGKLDFAARTGDGLLDVDLLNSNAARGFITTDVGDADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADDADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADAD-ADADADADADADADADADADVDIDWRDFLVEKPTVNPIYEGTKTISGSSIYKNMNINALLKSLQSDAPVGTTFYINLTLPDGTV-IGNVLIHADGTYTINIPNYNLKAGDVIHLQVTAKYGDEVKTSDDVSVTVLPLVDSDADADADADADADADADADADGGPNPSTNGGTTGTSNGGTGVTVTNMSSNGSGTMLSSGYSADGTTSISASDL--STGDTNSSLPWVGLGLFSLAGAFLLRLFRK..... 903
11 -30.900IDP05070 putative surface protein [Clostridium difficile 630] CD3246 [Peptoclostridium difficile 630]  ali follow..  4............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TAFTPIVSYADEVTSNDTILNGEEQSNGQTPDVEKPSDGQVPGGEKPSDSQVPDGEKPSDGQDGEKPSDGQIPDGEKPSDGQIPDGEKPSDGQIPEKPSDGQMPDGEKTSDSQTPDVEKPSDGQMPDGEKPLDEQTPEEEKPLEEEIVIEEMSLKQDIDKILDMTLSQINKIVYNFWEDEEDVKADEQSEINQVFTSEDSFISLWYDKKAKVKNSCLLKEIDGSDRPYHDLRFDDITKTLTFDYVIKGLVGASSKDDKYVIEGEDGEQTAFCYNNHLRPPSSNGKSPYLPAEDFNGQENQNEEAVKSILYAGSEFDGFGYKQQFNLGGEENELMTYSATQSAIWIILGQMDEQERLKQYQGSINLCDKLIERAKTEEERAEYQKKKEVAINIKAYLEALLKAGREELKPNNTGKPSLSNGLTKINFEKNEDGTYETEAVALVGYSGVVKLRLPDGVTAYDVDGNIIGTGEVEISTQQKFKLKSVGKPDAKANISAVSYDYIFPKAIQYYKAVLDLGQKDHSSSLPSSKQNLLSYTIEKKNGQEVNFNIGLPTDDDDVVNPPVPPIDDDVVNPPVPPTDDTNGHKPKPSPPIDDTVINPPVPPMDDTIINPPVPPTEDAVLNPPVPPMEDAV--LNPPVPPTDDTVLNPPVPPVSDTVEKTPELSRDDTIVKSPKTGDETQLMSYV............. 690
12 -30.600IDP91749 Q9DUM3_HHV8 [Human herpesvirus 8]  ali follow..  312...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DNEISKESQVDKDDNDNKDDEEEQETDEEDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEEDEEEDEEEDEEEEDEEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPLQEPQQQEPQQQEPQQQEPQQQEPLQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELDEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQEQELEEVEEQEQEQEEQELEEVEEQEQEQEEQEEQELEEVEEQEEQELEEVEEQEEQELEEVEEQEQQGVEQQEQETVEEPIILHGSSSEDEMEVDYPVVSTHEQIASSPPGDNTPDDDPQPGPSREYRYVLRTSPPHRPGVRMRRVPVTHPKKPHPRYQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQPGENQGPGDSPQEM...... 1035
13 -29.900IDP06506 gene: fms22; LPXTG family cell surface protein Fms22 [Enterococcus faecium DO] AFK59070 [Enterococcus faecium DO]  ali follow..  21............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................NQTVHTEEIETAKWTETKWANVNRITFQDEFSSFNSGVAKLRKGQTATIKAKIDYSGDLAPILQSAVTFENVDPALSIGYDENTLTIQHKQAIFTFTVTLNQDLLKPALFTVKVSDGLPNDHHHLTPYSQRQTIEQDSAIDSGGDLVEEPTDKPENENKPEVPPTENPDGEQKPEIEPGEEPDTETQPEPDNESKPEITPGEKP-------DVDPEEKPDVTPEPDTDSGNQTVPETNPDTDNETENPEKPEVAPEEKPDVTPEPDTDSGNQTVPETNPDTDNETENPEKPEVDPEEKPDVTPEPDTDARDQGIPEKIN-----KKTIQEDGKKESKKSNLAILKINEEQLNKKSRIFDSAQSAETLKSSKDTTFASPETKNKQLPKSGESQNKVILWSGIILLSIATMLSAKRFKQNRS...................................... 428
14 -29.500IDP90350 hypothetical protein CT456 [Chlamydia trachomatis D/UW-3/CX] CT456 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  2.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TNSISGYQPTVTTSTSSTTSASGASGSLGASSVSTTANATVTQTANATNSAATSSIQTTGETVVNYTNSASAPNVTVSTSSSSTQATATSNKTSQAVAGKITSPDTSESSETSSTSSSDHIPSDYDDVGSNSGDISNNYDDVGSNNGDISSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSDGAAAAALNSLRGSSYTTGPRNEGVFGPGPEGLPDMSLPSYDPTNKTSLLTFLSNPHVKSKMLENS-DQVCSIKVQNGKTKESGDWDSLVEPMVSAKAKTCVAYGPWNSQEASSGYTPSAGTQAGPSSEDDGISFSNETPGAGPAAAPSPTPSSIPIINVNVNVGGTN 537
15 -28.900IDP01843 gene: actA; actin-assembly inducing protein precursor [Listeria monocytogenes EGD-e] lmo0204 [Listeria monocytogenes EGD-e]  ali follow..  10  29................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AATDSEDSSLNTDEWEEEKTEEQPSEVNTGPRYETAREVSSRDIKELEKS-----NKVRNTNKADLIAMLKEKAEKGPNINNNNSEQTENAAINEEASGADRPAIQVERRHPGLPSDSAAEIKKRRKAIASSDSELESLTYPDKPTKVNKKKVAKESVADASESDLDSSMQSADESSPQPLKANQQPFFPKVFKKIKDAGKWVRDKIDENPEVKKAIVDKSAGLIDQLLTKKKSEEVNASDFPPPPTDEELRLALPETPMLLGFNAPATSEPSSFEFPPPPTDEELRLALPETPMLLGFNAPATSEPSSFEFPPPPTEDELEIIRETASSLDSSFTRGDLASLRNAINRHSQNFSDFPPIPTEEELNGRGGRPTSEEFSSLNSGDFTDDENSETTEEEIDRLADLRDRGTGKHSRNAGFLPLNPFASSPVPSLSPKVSKISAPALISDITKNPSQPLNVFNKKTTTKTVTKKPTPVKTAPKLAELPATKPQETVLRENKTPFIEKQAETNKQSINMVIQKEATESDKEEMKPQTEEKMVEESESANNANGKNRSAGIEEGKLIAKSAEDEKAKEEPGNHTTLILAMLAIGVFSL-G.. 627
16 -28.200IDP06379 gene: ORF45; ORF45 [Human herpesvirus 8] YP_001129397 [Human herpesvirus 8]  ali follow..  6...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................RTSSSTHDEERMLPIEGAPRRRPPVKFIFPPPPLSSLPGFGRPRGYAGPTVIDMSAPDDVFAEDTPSPPATPLDLQISPDQSSGESEYDEDEEDEDEEENDDVQEEDEPEGYPADFFQPLSHLRPRPLARRAHTPKPVAVVAGRVRSSTDTAESEASMGWVSQDDGFSPAGLSPSDDEGVAILEPMAAYTGTGAYGLSPASRNSVPGTQSSPYSDPDEGPSWRPLRAAPTAIVDLTSDSDSDDSSNSPDVNNEAAFTDARHFSHQPPSSEEDGEDQGEVLSQRIGLMDVGQKRKRQSTASSGSEDVVRCQRQPNLSRKAVASVIIISSGSD-------TDEEPSSAVSVIVSPSSTKGHLPTQSPSTSAHSISSGSTTTAGSRCSDPTRILASTP--PLCGN. 398
17 -28.000IDP92700 hypothetical protein SAVC_07990 [Staphylococcus aureus subsp. aureus VC40] YP_005291191 [Staphylococcus aureus subsp. aureus VC40]  ali follow..  1282................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TAEVAKRIEAVKQTPNATDEEKQAAVNQINQLKDQAINQINQNQTNDQVDTTTNQAVNAIDNVEAEVVIKTKAIADIEKAVKEKQQQIDNSLDSTDNEKEVASQALAKEKEKALAAIDQAQTNSQVNQAATNGVSAIKIIQPETKVKPAAREKINQKANELRAKINQDKEATAEERQVALDKINEFVNQAMTDITNNRTNQQVDDTTSQALDSIALVTPDHIVRAAARDAVKQQYEAKKRE-------EQAEHATDEEKQVALNQLANNEKRALQNIDQAIANNDVKRVETNGIATLKGVQPHIVIKPEAQQAIKASAENQVESIKDTPHATVDELDEANQLISDTLKQAQQEIENTNQDAAVTDVRNQTIKAIEQIKPKVRRKRAALDSIEENNKNQLDAIRNTLDTTQDERDVAIDTLNKIVNTIKNDIAQNKTNAEVDRTETDGNDNIKVILPKVQVKPAARQSVGVKAEAQNALIDQSDLSTEEERLAAKHLVEQALNQAIDQINHADKTAQVNQDSINAQNIISKIKPATTVKATALQQIQNIATNKINLIKANNEATDEEQNIAIAQVEKELIKAKQQIASAVTNADVAYLLHDNEIREIEPVINRKASAREQLTTLFNDKKQAIEANIQATVEERNSILAQLQNIYDTAIGQIDQDRSNAQVDKTASLNLQTIHDLDVHPIKKPDAEKTINDDLARVTAL--QNYRKVSNRNKADA... 1999
18 -27.900IDP90339 hypothetical protein CT050 [Chlamydia trachomatis D/UW-3/CX] CT050 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  2...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................NDTKNNISSSFWNPNKVVTKVLLKVSETGIESTPGIVKHNQLITQSENPTDPTD--------AVTFKYLKENYTKENDPNPGFLPTTGGTMTGDIDMQGNNVTDIVMYTNGQQNPTDDSAVTIGYLNEKADEIKSNDQITTAVAGLSNINSQISTLHQLLGIAEDPDTVTNPDLLKTSGGTVYEDIDMSSNTVSDLGTPTNKDTKSAINVEFVQAKITSPQMAFLKNNDTNLSNITVSEYFNWLQDPTQAPTPEPDPDPEPAPEPEPDTSDSSGSGSENPADPAPTNPSDSNAQNNPTPSSNGATASIRKLAATTTTVPTDTEIAPAAEDPNLPNTTFSEKSPLWEEFFSFSDSSRSEMVIQKTGILTFSMQGTWENPSSSQTPSTDPISLELTVTPPTTDTPPESPPSPPEAPAPEATPSPTNNNLTASITKTFSRKYNLSATPSPTPTTPTEPTTITKTLSLSSGQSCTLQIPVQATRSVLKLKYVNPNNNSSGGSSGSGGSSQPETTPTGITLQSFSWSLVLTPGEITKATSTPSTPSQP........................................................................ 536
19 -26.700IDP91682 gene: ORF73; nuclear antigen LANA [Murid herpesvirus 4] MuHV4gp74 [Murid herpesvirus 4]  ali follow..  2.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................PTSPPTTRNTTSGKTRSGCKRRCFNKPAAMPPKRRRAPKRPAPPPPPGCQGDEESSQGTQTPNPPSPPVPPSSPTLPSSPVPPSSPVHEPPSPSPPPAPPSPDVDVEGLDVGETDDPGPPPPKRYSRYQKPHNPSDPLPKKYQGMRRHLQVTAPRLFDPEGHPPTHFKSAVMFSSTHPYTLNKLHKCIQSKHVLSTPVSCLPLVPGTTQQCVTYYLLSF-----VEDKKQAKKLKRVVLAYCEKYHSSVEGTIVKAKPYFPLPEPPTEPPTDPEQPSTSTQASGTQHGPTASLDAGAEQGATGSPGSSPGQQGQGSQT................. 314
20 -25.900IDP06369 gene: vIRF-4; vIRF-4 [Human herpesvirus 8] YP_001129412 [Human herpesvirus 8]  ali follow..  111................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................QLVRTPFKNCTYCYGAAYGPEKLQRFIQCLLSPPMQTTATRRSDTREQSYEEAGAAAPAPPKAPSGLRGRPRKSNRYYNVGDITTEQKAACSVWIPVNEGASTSGMGSSGTRQVTQASSFTWRVPGDPPAPSTLTGPSDPHSSGAGLPGTAPPKPQHETRLAGTVSGVSGVAQTPGDTGQLAPPMRDGSRLPSTSPWIPACFPWGDLPVTGWWPQGASGLPEKVHPPTTGQFDPLSPRWTYTGIPSSQLNPAAPSWIPPHAQAGTFVGEFSQGAPLAPQGLLPQSGQCASAWLPRRETGAEGACGASTEGRAPQGAASERVYPFEPQPPSAPAPGYAKPSCYNWSPLAEPPATRPIRAPVWHPPVGHAVVPEVRTPLWIPWSSGGAPNQGLSHTQGGASATPSAGAPPTPEVAERQEPSSSGIPYVCQGDNMATGYRRVTTSSGALEVEIIDLTGDSDTPSTTVASTPLPVSGPRVFQPTVLYSAPEPAVNPEVSHLPTELERRECVCPGSGERPRVPLVSTYAGDRYAPEQSLVPPPLGLPLSNLQGEDICTWEEGLGNILSELQEEPSSSTRQATDRRRPRSRSPHGRRTPVSHSGPEKPPSKMFFDPPDSQ 731
21 -25.900IDP06468 gene: A5L; A5L [Monkeypox virus Zaire-96-I-16] NP_536542 [Monkeypox virus Zaire-96-I-16]  ali follow..  5...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................NKFSQGLAESSTPKSSIYYSEEKDPDTKKDEAIEKSQESYYQRQLREQLARDNMMVASRQPTQPLQPTIHITPQPVPTPTPAPILLPSSTAPVLKPRQQTNTSSDMSNLFDWLSADTDAPASTLLPALTPSNTVQDIISKFNKDQKMTTPSTQPSQTLPTTTCTQQSDGSISCTTPTVTPLQPPIVATVCTPTPTGGTVCTTAQQNPNPGAASQQNLDDMTLKDLMSSVEKDMRQLQAETNDLVTNVYDAREYTRRAI-DQIIQLVKGFERFQK................................................................. 281
22 -25.100IDP91673 CD44_HUMAN [Homo sapiens]  ali follow..  121...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPREDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSTTLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSG--EASKSQEESSETPDQFMTADETR-NLQNVDMIG.. 741
23 -24.900IDP91942 immunoglobulin A1 protease [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007536 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  7...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EKQERFSFR----KLSVGLVSATIFFMSVLASSSVDAQETAGVHYKYVADSELSSEEKKQLVYDIPTYVENDDETYYLVYKLNSQNQLVELPNTGSKNERQAL--------AVSKKKVKNKTVLHLVLVAGMGNGVLVSVHALENHLLLNYNTDYELTSGEKLPLPKEISGYTYIGYIKEGKTTSDFEVSNQEKSAATPTKQQKV---DYNVTPNFVDHPSTVQAIQEQTPVSSTKPTEVQVVEKPFSTKLINPRKEEKQSSDSQEQLAEHKNLETKKEEKISPKEKTGVNTLNPQDEVLSGQLNKPELLYREETIETKIDFQEEIQENPDLAEGTVRVKQEGKLGKKVEIVRIFSVNKEEVSREIVSTSTTAPSPRIVEKGTKKTQVIKEQPETGVEHKDVQSGAIVEPAIQPELPEAVVSDKGEPEVQPTLPEAVVTDKGETEVQPESPDTVVSDKGEPEQVAPLPEYKGNIEQVKPETPVEKTKEQGPEKTEEVPVKPTEETPVNPNEGTTEGTSIQEAENPVQPAEESTTNSEKVSPDTSSENTGEVSSNPSDSTTSVGESNKPEHNDSKNENSEKTVEEVPVNPNEGTVEGTSNQETEKPVQPAEETQTNSGKIANENTGEVSNKPSDSKPPVEESNQPEKNGTATKPENSGNTTSENGQTEPEPSNGNSTEDVSTESNTSNSNGNEEIKQENELDPDKKVEEPEKKLELRNVSDIELYSQTNGTYRQHVSLDGIPENTDT-KSSAFKDV.... 767
24 -24.400IDP90291 high mobility group (HMG) box domain-containing protein [Toxoplasma gondii ME49] TGME49_081900 [Toxoplasma gondii ME49]  ali follow..  11...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KPWMRVTVSCALLPEVLKQGAEAGGTGNPSEQSSEDGSHHCSSNFQNSPVTSDLSVLDASPCGLPAEKRKPPHRETSISSNASQSEREIAPTATRRLSPKPETATSPSESSSLTAATLSNCSSRVQSSSDEKIGNCPSTSACSVSQTTASSEAPSWLSSGASTAQVLSERRGSIEEQPAPETSAAAVRVSRSSSDSENLFASCSASLRNLEPDDISDPENEAAAPACAETGASRAQDAAAVRADAENLGEGESHMETASTRAESLAKDAISSKVSRRGSAHTSSDASGQCQDALPSVGEGKPGEMNGREEDGEAEKPEASAESLQGSDGQANESEAPKPGGGRVDAKMRAKFKREFVRSWVDINRAPSWPPIKKNKYLSSDWKRVDLRTAAGEIRVETKKHVDNFEEQAENCPDAFKQRKLEQLRRRYKNPEFVHIPHREEVAMREREEAERRKRDKEESEKKKAAAKQPRCPVKRPCSAYLLFSVARRKELLKACGILSKGDDEPASQQVSESPEVPREGQRKRRASSASQAAAPVPAAANKRRKAEKDEPSSPEETKRGQVVAAAGLKRGAARPACVGDETAQKLAGWLAKDGA------ANVRTLCAELTREVAREWGNMRPEEKKPWEQLAEKEKIRYAKAVRTWREKLKKKKSGRETATRKRKVPCSRKGHGTEKGEKAGKVKPQADTSPREAA-----PEGTETRDHEDVQAGAKDRAAT-----QKE---R. 880
25 -24.200IDP91616 gene: ECs2715; EspF-like protein [Escherichia coli O157:H7 str. Sakai] BAB36138 [Escherichia coli O157:H7 str. Sakai]  ali follow..  3.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................NNVSSLFPTVNRNITAVYKKSSFSVSPQKITLNPVKISSPFSPSSSSISATTLFRAPNAHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPPLPVQNEQSRPLPDVAQRLVQHLAEHGIQPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRPLPDVAQRLMQHLAEHGINTSKRS...................................... 337
26 -24.000IDP06012 membrane-attack complex / perforin domain-containing protein [Toxoplasma gondii ME49] EEB00555 [Toxoplasma gondii ME49]  ali follow..  3..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSAIGGIGPTESRLQHIPFSTTRYLPIRSHVLQSTVERIESPEALNEVPTKVERNEFTEKGDKTEQVLTAQADHKSLLEGRSVRLESTSTAPDDDFDFLFEDDTPKKPKSRVNKGTSSDETSPGDRSSGEGSSDSDSLLSVVHRTKGNATQANKNQTRITHPKSKAQHQKKVTKKQGIPGSDSLGTSSADFDFDIDSSSNTQADDSQRQSLGDSSALDLFGSDTGDTGDIFGFSNSSSDGGNAAANDGGLFSSSGMGPTGASDETSANPLGSILGGVLNPFAQQQSITPMTDKADEWSKENMKAFEEKMPKKMRDDGSPDS................... 323
27 -24.000IDP06534 Surface protein from Gram-positive cocci, anchor region [Enterococcus faecium DO] EAN10892 [Enterococcus faecium DO]  ali follow..  22........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................GISTSANERANENLSFTVKTDRIVYDMTQQVITIPVKPNKSVNASDVHAVLTYGWDGNGSSEKVIGEVYLKDVQWTAGIEYTIMISAELSIDEIKSKDKVDLIVFYDGQMTITENLKPSSWTVVGPPSSTDSTSSESSTENTSGESSTESTSSESSTENTSSESSTESTSSESSTGSTSSESSTESTSSESSTGSMSSESSTGSTSSESSTGKVNNELDLVPIIPTKEQKRNAGSNLKSVLKQPDFVSRGIDHQEKAKETDNRKSDLPETGSRTLNKLITWMGVLLILIVGASYFRSLFHR................. 322
28 -23.400IDP91038 hypothetical protein SAHV_2481 [Staphylococcus aureus subsp. aureus Mu3] SAHV_2481 [Staphylococcus aureus subsp. aureus Mu3]  ali follow..  398.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................INANGWMRTDLKGSEFTFTPEAPKTITELEKKVEEIPFKKERKFNPDLAPGTEKVTREGQKGEKTITTPTLKNPLTGEIISKGESKEEITKDPINELTEYGPETIAPGHRDEFDPKLPTGEKEEVPGKPGIKNPETGDVVRPPVDSVTKYGPVKGDSIVEKEEIPFEKERKFNPDLAPGTEKVTREGQKGEKTITT----PTLKNPLTGEIISKGESKEEITKDPINELTEYGPETIAPGHRDEFDPKLPTGEKEEVPGKPGIKNPETGDVVRPPVDSVTKYGPVKGDSIVEKEEIPFKKERKFNPDLAPGTEKVTREGQKGEKTITTPTLKNPLTGEIISKGESKEEITKDPINELTEYGPETITPGHRDEFDPKLPTGEKEEVPGKPGIKNPETGDVVRPPVDSVTKYGPVKGDSIVEKEEIPEKERKFNPDLAPGTEKVTREGQKGEKTITTPTLKNPLTGEIISKGESKEEITKDPVNEGEKIPQGHKDIFDPNLPTDQTEKVPGKPGIKNPDTGKVIEEPVDDVIKHGPKTGTPETKTVEIPFETKREFNPKLQPGEERVKQEGQPGSKTITTPITVNPLTGEKVGEGQPTEEITKQPVDKIVEFGGEKPKDPKGPENPEKPSRPTHPSGPVNPNNPGLSKDRAKPNGPVHSMDKNDKVKKSKIAKESVANQEKKRAELPKTGLESTQKGLIFSSIIGI-LARRRKN..... 1115
29 -23.200IDP91911 G5 domain family protein, partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005012 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  239............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................RDGVDGKSPTVTAVRKDEAGHKGVEITVDNHDGSQPTTVFVQDGAKGETGAIGQDGQTPTITTQRGQDGQSTVVTITTPGKDPVTFTVKDGKNGKDGRAPKIKVEDITSPSRIRRATDAAATPTRNGIRVTVYDDVNDNGVYDGGVDKVLNSKDIYNGIDGRDGSAPTITTKDNGDGTHTITVQNPDGSESTTVVKDGKDGKTANITTTENPDGSHTITVTNPDGSTKETVVKNGKDGKTPKVEVTDNNDGTHTVKVTDGDGNVTNAIIKDGKDGKAATATTTENPDGSHTVTITNPDGTKNEFVVKNGRDGVDGRTPTASVRDNGDGSHTIVITNPEGVTTETTVRDGKSPKVTITDEQNGTHKISVLNGDGTTTETIIKDGKSPVATVRDNQDGTYTIRVENGNGTVSETTVRDGKSPTAKVVDNGDGTHTITVVNSDGTTTTTTVRYGREPKLEVIDNNDGSHTIKVTGADGKETTTTIFDGKSPKANIVDNGDGTHTLTIVDSDGREYKSIIKDGKDGKDGVSPTVTVENNNDGTNPDGSKTEMVIKDGKDGKSPKVSVEDNGDGSHTITITVTKTVIKDGKDGRDGRDGRDGKDGKCGCQDKPVTPSNDKPVPPAPNVPTPEVLVKPVPAQPTPNVPTPEVPVQPTPAVPTPEVPVPEQPVVPTPAQPATPVNANPVAPTTGKENRGDKLPETGSQSDYISVLLYVGR. 970
30 -23.100IDP91916 spermidine/putrescine ABC transporter, permease protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100001122 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  2...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................FKKDRFSIR----KIKGVVGSVFLGSLLMAPSVVDAATYHYVNKEIISQEAKDLIQTGKPDRNEVVYGLVYQKDQLPQTGTEASVLTAFGLLTVGSLLLIYKRKKIASVFLVGAMGLVVLPSAGAVDPVATLALASREGVVEMEGYRYVGYLSGDILKTLGLDTVLEETSAKPGEVTVVEVETPQSTTNQEQARTENQVVEAEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEPPVEQAKGPEQPVQPTQAEQPRIPKDSSQPEDPKEDRGAEETPKQEDEQPAEAPEIKVEEPVESKEETKTAKGTQEEGKEGQAPVQEVNPEYKVTTGTVEKSTESELDFTTEVVPDDTKYVDEEVVERQGSKGVQVTKTTYETVEVVETDKVLSTTTEVKTPAVPKVVKKGTKPVKGTAVETREEVIPFATKEQEDDTLKRGTRQVAQEGVNGKKQITETYKTIRGEKTNEAPTVEETVLQAPQDEIIKKGTKGLEKPTLEWVKTDKDVLKKSATASYTLNKPDGVEIKSIKVALKDNTGTVIKEVTVEENNLNATLDNLKYYQGYTLSTTMVYNRGEGEETETLEDKEVQLDLKKVEIKNIKETSLMSVDDAGVETDKSLLTEKPTDVAPLYLRVTTHDNKTTRLAVSSVEEVVVDGKTLYKVVAKAPDLVQRREDDTLSEEYVHYFEKQLPKVDNVYYSFNELITDMQKNPTGT. 755
31 -22.900IDP91738 Q5YB85_STRSG [Streptococcus sp. `group G`]  ali follow..  25...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TEVKAAENTYDRWKAQTEEARTDKLIAGFANLDADVTKMMDELQKLKDFSKQNNSIGEYARYLQKLNDQFQEYYEQVVGDDSRRVLAKELAKNTELNEKLSELSTTSQALAKELQEQKENYDLVKTVHADTVKKHQKLVDEITKKLGEEETERHSLQEELNKAQQELAQKQQELKDKQADYDLVVETHAYTVKEHQKLVDEITKKLGEEETERHSLQEELNKAQQELAQKQQELEAEKLAKEGIVDSLTAYVTEKEAEVKKLTDSLAAKDAEIQEKEAEKDRQQHMYEAFMSQLKEKVEKQEQELAKLKQLETINNNLLGNAKDMIAKLSAKNEQLASDKAKLEEQNKISDASRKGLRRDLNASREAKKQLEAEHQKLEEQNKISEASRKGLRRDLDASREAKKQVEKDLANLTAELDKVKEDKQISDASRKGLRRDLDAS--------REAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEKLAKQAEELAKLRAGKASDSQTPEATPGNKVVPGKGQASQAGTKPNQNKEPMKETKRQLPSTGEATNPFFTAAAL.... 598
32 -22.800IDP91504 putative translocation protein in type III secretion [Vibrio parahaemolyticus RIMD 2210633] VP1670 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  4..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KPSTDTPSTQPHSPQSPMPIDDHAMLQSRFERALKENPDQTKPQPNETNNQAALEAKKPFTENYSERSLASLHSTGSNQRKTAEKSAFAQNNDVVTENINNESDTSSPIALNTQDKMPSDMDANMKPDIRIPTTGDKKLPMEPSNKREKNADEQDAFERLVEDHDDSKTELAAAKTAESHESTQSPKDTKHIPTAGTKPNTVETVSDALASTLASTTVASATSASLASHPVTSTVHKTATKTEVNKHEGDSSLGFNSRNLKTPIPNDEHPKASQAERTLLDRAMLDSEKSNDKPMHQPVTTPITQGDVILKGISPPQPTQPTREVNQLIQQLVDKVYVALPTASNEKEVRSVTIRQEHALSIINQQARQDLAERNRMGFEQPLRVSISEQTSQHGHTQQDQQQSRQQRSVYEEWQ..... 441
33 -22.400IDP92687 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus str. Newman] YP_001331559 [Staphylococcus aureus subsp. aureus str. Newman]  ali follow..  10.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ITKKGMISNRLNK--FSIR----KYTVGTASILVGTTLIFGLGNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNKVKKGD----TINYDKNVIPSDLTDKNDPIDITDPSGEVIAKGTFDKATKQITYTFTDYVDKYEDIKSRLTLYSYIDKKTVPNETSLNLTFATAGKETSQNVTVDYQDPMVHGDSNIQSIFTKLDEDKQTIEQQIYVNPLKKSATNTKVDIAGSQVDDYGNIKLGNGSTIIDQNTEIKVYKVNSDQQLPQSNRIYDFSQYEDVTSQFDNKKSFSNNVATLDFGDINSAYIIKVVSKYTPTSDGELDIAQGTSMRTTDKYGYYNYAGYSNFIVTSNDTGGGDGTVKPEEKLYKIGDYVWEDVDKDGVQGTDSKEKPMANVLVTLTYPKSVRTDANGHYEFGGLKDGETYTVKFETPTGYLPTKVNGTTDGEKDSNGSSVTNGKDDMSLDTGFYKEPKYNLGDYVWEDTNKDGIQDANEPGIKDVKVTLKDSTGKVIGTTTTDAS-------GK. 769
34 -22.300IDP91352 electron transport complex protein RnfC [Vibrio vulnificus CMCP6] VV1_3095 [Vibrio vulnificus CMCP6]  ali follow..  10  440..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AKAEIRTRAQEADAAERAKLRFEEKKARMEREKEERENRFKKAAEDRRKEMKSTGGDDAIAAAIARVKAQKTQDSEQAPSVKPAVAAAIAKAKAKQAAAADSGSSEPDNSEMVKLREERKRLARERKAEKEQSKTPDSEEQGDKKSAVAAAIARAKAKKAQQPPLASSESSADEPEDKKAAVAAAIARAKARKAQQTDEPAPEQNREESQAAEDAPKKAAVAAAIARAKARKAQQTDESAPEQNREESQPAEDDPKKAAVAAAIARAKARKAQQTSEPAPEQNREESQPAEDDPKKAAVAAAIARAKARKAQQTDEPAPEQNREELQPTEDDPKKAAVAAAIARAKARKAQQTDEPAPEQNREESQPAEDDPKKAAVAAAIARAKARKAQQTDEPAPEQNREESQPAEDDPKKAAVAAAIARAKARKAQQTDEPAPEQNREESQPAEDDPKKAAVAAAIARAKARKAQQAEQKQNTEENE........ 919
35 -22.100IDP92699 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus USA300_TCH1516] YP_001574462 [Staphylococcus aureus subsp. aureus USA300_TCH1516]  ali follow..  10.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ITKKGMISNRLNK--FSIR----KYTVGTASILVGTTLIFGLGNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNKVKKGDT---TINYDKNVIPSDLTDKNDPIDITDPSGEVIAKGTFDKATKQITYTFTDYVDKYEDIKSRLTLYSYIDKKTVPNETSLNLTFATAGKETSQNVTVDYQDPMVHGDSNIQSIFTKLDEDKQTIEQQIYVNPLKKSATNTKVDIAGSQVDDYGNIKLGNGSTIIDQNTEIKVYKVNSDQQLPQSNRIYDFSQYEDVTSQFDNKKSFSNNVATLDFGDINSAYIIKVVSKYTPTSDGELDIAQGTSMRTTDKYGYYNYAGYSNFIVTSNDTGGGDGTVKPEEKLYKIGDYVWEDVDKDGVQGTDSKEKPMANVLVTLTYPKSVRTDANGHYEFGGLKDGETYTVKFETPTGYLPTKVNGTTDGEKDSNGSSVTNGKDDMSLDTGFYKEPKYNLGDYVWEDTNKDGIQDANEPGIKDVKVTLKDSTGKVIGTTTTDASGK--DLNGN. 779
36 -22.000IDP91181 wall surface anchor family protein [Chlamydophila felis Fe/C-56] CT578 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  7...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SSSDSSNLKNVLSQVIASTPQGVPNADKLTDNQVKQVQQTRQNRDDLSMESDVAVAGTAGKDRAASASQIEGQELIEQQGLAAGKETASADATSLTQSASKGASSQQCIEDTSKSLELSSLSSLSSVDATHLQEIQSISSAMGATNELSLTNLETPGLPKPSTTPRQEVMEISLALAKAITALGESTQAALENFQSTQSQSANMNKMSLESQGLKIDKEREEFKKMQEIQQKSGTNSTMDTVNKVMIGVTVAITVISVVSALFTCGLGLIGTAAAGATAAAAGATAAATTATSVATTVATQVTMQAVVQVVKQ-------------AIIQAVKQAIVQAIKQGIKQGIKQAIKQAVKAAVKTLAKNVGKIFSAGKNAVSKSFPKLSKVINTLSDMQKELAQIQKEVGALTAQSEMMKAFTLFWQQASKIAAKQTESPSETQQQAAKTGAQIAKALS... 477
37 -21.900IDP91906 zinc metalloprotease ZmpB [Streptococcus pneumoniae str. Canada MDR_19F] SpneCMD_010100004020 [Streptococcus pneumoniae str. Canada MDR_19F]  ali follow..  2...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................FKKDRFSIR----KIKGVVGSVFLGSLLMAPSVVDAATYHYVNKEI------ISQEAKDLIQTGKPDRNEVVYGLVYQKDQLPQTGTEASVLTAFGLLTVGSLLLIYKRKKIASVFLVGAMGLVVLPSAGAVDPVATLALASREGVVEMEGYRYVGYLSGDILKTLGLDTVLEETSAKPGEVTV--------VEVETPQSTTNQEQARTENQVVEAEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEPPVEQAKGPEQPVQPTQAEQPRIPKDSSQPEDPKEDRGAEETPKQEDEQPAEAPEIKVEEPVESKEETKTAKGTQEEGKEGQAPVQEVNPEYKVTTGTVEKSTESELDFTTEVVPDDTKYVDEEVVERQGSKGVQVTKTTYETVEVVETDKVLSTTTEVKTPAVPKVVKKGTKPVKGTAVETREEVIPFATKEQEDDTLKRGTRQVAQEGVNGKKQITETYKTIRGEKTNEAPTVEETVLQAPQDEIIKKGTKGLEKPTLEWVKTDKDVLKKSATASYTLNKPDGVEIKSIKVALKDNTGTVIKEVTVEENNLNATLDNLKYYQGYTLSTTMVYNRGEGEETETLEDKEVQLDLKKVEIKNIKETSLMSVDDAGVETDKSLLTEKPTDVAPLYLRVTTHDNKTTRLAVSSVEEVVVDGKTQRREDDTLSEEYVHYFEKQLPKVDNVYYSFNITDMQKNPTGT. 755
38 -21.800IDP91577 gene: ECs4550; EspF protein [Escherichia coli O157:H7 str. Sakai] BAB37973 [Escherichia coli O157:H7 str. Sakai]  ali follow..  10  3..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................NGISNAASTLGRQLVGIASRVSSAGGTGFSVAPQAVRLTPVKVHSPFSPGSSNVNARTIFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTGPSGLPPLAQALKDHLAAYEQSKKG.................................................................................................................. 248
39 -20.800IDP06395 gene: ORF50; ORF50 [Human herpesvirus 8] YP_001129401 [Human herpesvirus 8]  ali follow..  215....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................IMTKGQLAPENFYSITGSAEKRRPITTGKVTGLSYPGSGLMPESLILPILEPGLLPASMVDLSDVLAKPAVILSAPALSQFVISKPHPNMPHTVSIIPFNPSGTDPAFISTWQAASQNMVYNTSTAPLKPATGSSQTVSVKAVAQGAVITATTVPQAMPARGTGGELPVMSASTPARDQVAACFVAENTGDSPDNPSSFLTSCHPCDPNTVIVAQQFQPPQCVTLLQVTCAPSSTPPPDSTVRAPVVQLPTVVPLPASAFLPALAQPEASGEELPGGHDGDQGVPCRDSTAAATAAEATTPKRKQRSKERSSKKRKALTVPEADTTPSTTTPGTSLGSITTPQDVHATDVATSEGPSEAQPPLLSL-PPPLDVDQSLFALLDEAGPETWDVGSPLSPTDDALLSSILQGLYQLDTPPPLRSPSPASFGPESPADIPSPSGGEYTQLQPVRATSATPANEVQESGTLYQL............. 682
40 -20.800IDP92689 hypothetical protein SAVC_09040 [Staphylococcus aureus subsp. aureus VC40] YP_005291395 [Staphylococcus aureus subsp. aureus VC40]  ali follow..  2.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SYHWFKKMLLSTSILILSSSSLGLATHTVEAKDNLNGEKPTTNLNHNITSPSVNSEMNNNETGTPHESNQTGNEGTGSNSRDANPDSNNVKPDSNNQNPSTDSKPDPNNQNSSPNPKPDPDNPKPKPDPKPDPDKPKPNPDPKPDPDNPKPNPDPKPDPDKPKPNPDPKPDPDKPKPNPNPKPDPNKPNPNPSPDPDQPGDSNHSGGSKNGGTWNPNASDGSNQGQWQPNGNQGNSQNPTGNDFVSQRFLALANGAYKYNPYILNQINKLGKDYGEVTDEDIYNIIRKQNFSGNAYLNGLQQQS-NPLKSEEIGSMPDLKKPEDKPDSKQRSFEPHEKDDFTVVKKQEDNKKSASTAYSKSWLA... 388
41 -20.600IDP00754 gene: spa; immunoglobulin G binding protein A precursor SACOL0095 [Staphylococcus aureus subsp. aureus COL]  ali follow..  31..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENP........ 482
42 -20.400CPX_91720_91682 Complex of TF65_HUMAN with O41974_MHV68 [Undefined organism]  ali follow..  253...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................RTPPYADPSLQAPVRVSMQLRRPSDRELSEPME-----------------LPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISSXMPTSPPTTRNTTSGKTRSGCKRRCFNKPAAMPPKRRRAPKRPAPPPPPGCQGDEESSQGTQTPNPPSPPVPPSSPTLPSSPVPPSSPVHEPPSPSPPPAPPSPDVDVEGLDVGETDDPGPPPPKRYSRYQKPHNPSDPLPKKYQGMRRHLQVTAPRLFDPEGHPPTHFKSAVMFSSTHPYTLNKLHKCIQSKHVLSTPVSPLVPGTTQQCVTYYLLSFVEDKKQAKKLKRVVLAYCEKYHSSVEGTIVKAKPPLPEPPTE------PPTDPEQPSTSTQASGTQHGPTAS-------------LDAGAEQGATGSPGSSPGQQGQGSQT 866
43 -20.000IDP06427 gene: B21R; B21R [Monkeypox virus Zaire-96-I-16] NP_536609 [Monkeypox virus Zaire-96-I-16]  ali follow..  350.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DEVINNITLTNIIRNSVSTTNSRKRRDLNGEFEFSTSKE------ESYGVNDDISHCFASPRRRRSDDKKEYMDMKLFDHAKKDLGIDSVIPRGTTHFQVGASGASGGVVGDSFPFQNVKSRASLLAEKIMPRVPITATEADLYATVNRQPKLPAGVKSTPFTEALASTINQKLSNVREVTYASSNLPGSSGYVHRPSDSVIYSSIRRSRLPSDSDSDYEDIQTVVKEYNERYGRSVSRTQSSSSESDFEDIDTVVREYRQKYGNAMAKGRSSSPKPDPLYSTVKKTTKSLSTGVDIVTKQSDYSLLPDVNTGSSIVSPLTRKGATRRRPRRPTNDGLQSPNPPLRNPLPQHDDYSPPQVHRPPTLPPKP---VQNPTQLPPRPVGQLPPPIDQPDKGFSKFVSPRRCRRASSGVICGMIQSKPNDDTYSLLQRPKIEPEYAEVGNGIPKNNVPVIGNKHSKKYTSTMSKISTKFDKSTAFGAAMLLTGQQAISQQTRSTTLSRKDQMSKEEKIFEAVTMSLST----STLTSAGMT 880
44 -19.800IDP91910 surface protein PspC, partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100003565 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  15  1.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KPKPEVKPQLEKPKPEDKPQLEKPKPEVKPQLEKPKPEVKPQLEKPKPEDKPQLEKPKPEVKPQLEKPKPEVKPQLEKPKPEDKPQLEKPKPEVKPQLEKPKPEVKPQPEKPKPDNSKPQADDKKPSTTNNLSKDKQPSNQASTNEKATNKPKKSLPSTGSISNLALEIAGLLTLAGATILAKKRMK...................................................................................................................................................................................................................... 187
45 -19.600IDP93916 type III secretion protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007700 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  5........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KQVAHSAPPDIRKEEPANVSRPVTRNTDNGQAVKSFQQEVQKKMTELLAKAKQRKKQAEEQLAPALAPLMMPINSMPLSKQLALPNMAQGHETAEQPQAMEKVGAKPTPVVDKVSGGVTVETLLKPTATLTQLNVIPRDNGEQPLPGLIAVTSDNSEMPMVAVPSAKREGNKDEMSDTSVSQDRSDSSGSTVKQPIAASFESLREATSSVPLAESQENTLGDEQTHLLTTQQLAGQPLATQPPAVTQPEEMKTPSKAEMTALPEPVATESEPTAGRRTLSYTFTQWTNSPMVKFELSTAMTDSAEVQLALQNNHLESENPLDRDERHDEERRGQQQSEQEDEK....... 355
46 -19.500IDP06413 gene: vIRF-2; vIRF-2 [Human herpesvirus 8] YP_001129414 [Human herpesvirus 8]  ali follow..  124.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................YLTQEPAMKNMLKALFGIYPHDDKHREKALRRSLRKKAQREAARKQAAAVATPTTSSAAEVSSRSQSEDTESSDSENELWVGAQGFVGRDMHSLFFEEPEPSGFGSSGQSSSLLAPDSPRPSTSQVQGPLHVHTPTDLCLPTGGL---PSPVIFPHETQGLLAPPAGQSQTPFSPEGPVPSHVSGLDDCLPMVDHIEGCLLDLLSDVGQELPDLGDLGELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSGQELPDL--------GDLSELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSSFQASDNVDDFIDCIPPLCRDDRDVEDQEKADQTFYWYGSDMRPKVLTATQSVAAYLSKKQAIYKVGDK-----EVYYFGE. 525
47 -19.300IDP91523 hypothetical protein TGME49_071960 [Toxoplasma gondii ME49] TGME49_071960 [Toxoplasma gondii ME49]  ali follow..  3...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................PPSAAKPVASYCDSGAGAPSSDAALTLPADAHAGKLSSGESREKETGEAAFLCAGVSAKPSLPPSMLSGLSPEMASSLRTSRASSSTDQDTEMCVEVERDVSTEPERTGVSCETLVTSTPVVTTGGEEGESEGESDDFSTCVAEDRDFTRVDDGTSAQESADSRGADSACVKSEWAFFEAHSSWRVSVVQDANDLENASNEDTEAASQCRLPAVSRPKDKTGENDFDDEETSRDLSILQENESTCCQEATDDANEETPRGCALCRGESDCIGDSCCGFVRSRDEREEGPTESSLDVTNLSRLQTEENEDAPSSVPETPRGCPVCRVDVDFGGGLEENSCCWQARDAEAVELHAADKQMGKLFTSLEYLRHQEQSCGSLESDTYESEDEESSYPSPRCFPSLP..... 404
48 -19.000IDP04210 ZZZ_0017 [Escherichia coli O157:H7 str. EDL933]  ali follow..  6..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SSLFPTVNRNITAVYKKSSFSVSPQKITLNPVKISSPFSPSSSSISATTLFRAPNAHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPPLPVQNEQSRPLPDVAQRLMQHLAEHGINTSKRS.......................................................................................................................... 243
49 -18.900IDP91664 gene: BBC3; bcl-2-binding component 3 isoform 4 [Homo sapiens] NP_055232 [Homo sapiens]  ali follow..  10  2.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLES----PVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN...................................................................................................................................................................................... 193
50 -18.100IDP91468 hypothetical protein VPA1370 [Vibrio parahaemolyticus RIMD 2210633] VPA1370 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  3.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KIKLPQQTSLAPSSETTQRLPVKISIKSICNKSICKTLHSLADKCHRFSKEIKQRSANHTPSSSHENLTTINLKSQNSAATFESTVELSIKHGSSIPPAPPLPGAIPPAPPLNLSKGAPKSSSNSLDSVNEDHSKLMEQIRQGVKLKSATKSLSADKSSADAHSKLMEELLTGGRKLKKVATSDIPAPPPLPSASTSKSPDSRNALLSEIAGFSKDRLRKTGSLETLNSSQSKDKESFEPTTHEEDLFKQSPKLSEQELDELANNLADYLFQAADIDWHQVISEKTRGLTTEEMAKSEHRYVQAFCREIKSADVASPESPKSGGGSVIDVALKRLQTGRERLFTTTDEKGNRELKKGDAILESAINAARMAISTEEKNTI--SNNVKSATFEVFCELPCMDGFAEQN---GKT 422
51 -17.800IDP90426 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_863 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  10  2...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DTPTPLSSVPTNASLKGEPGSSSQFSSAEKGVLKTSVGDVVLSQSIEDGGNETQISLVGVVNINMAQEELPTLVSPRTFIFLPPETVELEIQIAEMFQALEETPSSDSRSLQQKETSAQTPPAPSGKVSIFSLQAQGSSQTRSLPSSQ-ESLSPQQPARAIQGLNTPFSPAARCTIRAVPLSIVPHRRANPTSSQSVSHHSSRTYQTGHSTGTAQLSSQEWEFSSQTVKTCSTGREKRDGQQERHSDQEQNSDHSYQEEDLSDDMQVSSSKRSSHPEDENTEEVFSVSHFAYHAAPHPSSNLDQESNQSTFQKRPPSPMSLFSSQNATEEAPKEARVEMRLMARILGQAEAEAHEERTDNVDALTLLLSKINNEKGAI-----------DWNQDEEMRALVD-QAKKLGVPIGDSYDWSEEGKKLLKENIQMRKENMEKITQLERTDMQRHLQEVSARS 463
52 -17.800IDP91690 gene: KIAA2022; hypothetical protein LOC340533 [Homo sapiens] NP_001008537 [Homo sapiens]  ali follow..  310......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LKIRYESFQ---DNVRDKTTLLMQEDAQFNF--------FPS-VFT-----CPKRESKSGALKQSSDFSQFKVPDVSIIWGEEDKNLDKKKGKEEGQEDKGVEKKDGKDNGEKPALNKPCSGTEVEQLKNPKQGHLANSLETSGSFSDDSSFIEISYDAMGEIKDCSRYMARDTNSGSSSSQQNYGLRAKKVRYSEDYLYDVDSLEGEKVNERKEWLPVGSKEEDDDEWCPKKRRKVTRKEPPVIIK------------------------EKNMLVKLGKVDASETTVNLSENQLNKYAKLAPLKGFWQKKKKQRNTNTDSIKTPFSQKQSFEPGSFEVSFLPPARKRKSKLGNRHRIQRIPSIEISASSKQISLCNDQRHASNHKEDGGLKGTLKSAPLGAPSCANGSHLNDITGPDSVKVKAQDTEFKGPERKVLNKIKFKSEARLKSKKVKAAGQESKPIVQMSPLLENQSSKANLKNEVIPGTSNSSRLSEFHEAKAAKSSTFLPTTCSSEMPLSSANVTTNIPVIPGGYLQTLLDASDLSNNTSISYFSHHSPEQNEGSLTQTEKSFVPLQPTQDCVLTSSSDSELQQSSHNFKMESSNYRNVWPNKATSGTQEFMAEVSREIAPTQSSEFGASQVVSMENNLTPTTYNPICLNSGGSNCNKVLYDSMQDTQLPSDDSYQLCHFNNGEICFPFQQGPVNMDDGRLFSFDSMAPLSVSSSNYCSLSLKSCEKDGDDDAHCSPKLVIQQSIDEIAPLKESTDLLDISNFTPDK....... 1062
53 -17.500IDP05521 putative cell surface protein [Clostridium difficile 630] CD1858 [Peptoclostridium difficile 630]  ali follow..  10  50..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AVAQIKVEVEVNVKYIFEDEKVFKEEKIKAEKGRLLDSGDLPIIPDDMKFIDDFLFYEVKGDGKDEIIRKVTKIDVKDKETQTENESSKSEQSSQSNASKIENKGTQTELSKDDISKMEKESKELKEKLDKLNQEIKDKDKLSEKQKDKIKDLEEKIDKLKEKLEKGKDDKDLSADMKKEIDKLTDKIKELEKKANEVGRAPVMHNPTVTPISPISGIKQGTGNVSPQTSINSSGKGSATQESKGANTKDTNSNESKEKEKQVCYPNKLTPKQPANNGSHDSSLDGSSKNINTNKGVASEPSKARGTVTENKDNANKNYPIHHNDSKDNKETDKYSADARQFVTFTTKNGKTNHDEDSEKVMLLTEVSEDDLLNMVEKKAPEKEIVKEESQKEEPKQVKKEESSNTGTKKKEDKELEGFEEEDDDFFSEAEESENEVNEAVTEDKEDDEIE..... 526
54 -17.500IDP05002 hypothetical protein lmo0086 [Listeria monocytogenes EGD-e] lmo0086 [Listeria monocytogenes EGD-e]  ali follow..  2...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KKNILVVIIVSVLAI-SAIVSAFFLM---------------------------------------------RDDAYAIETEGFTYSPKGKVVDFSSEAKYNDTWINNEKTITDKKEMKPINLARTLFLKDGRGKSVAVKSASDLIELPSKTSITESKGSYKAKSDSNKTLAQLPKGTVVKLAEGRYIILDNAYLKNKQGLNKKLPKNVLVSIDENKKVMLMGDKTIEELGGDDAYIEMENNHYHFDLKKEMLVSQTAKETD--------------------------------------------------------DIRSIKVEIDDNAEKRSLKTAKETEKETTKDSTEKESEKQSNDASGQKSAQNNERSESKDDQTQDASGNNTNGSANNNTARSNGTGGSNSDTNGSQPGGTQNKPNEGDVNKANEIIKKLNEAENTNTFQVPIVDVNLTVKGQVAAAKLKLTDSSKRLNSLEAILYDSKNNIVKKEKLNSTKANQNFTFNNLKYGETYQVVVQGSYKSASNKNQDTIFFRQTVEAKPVVLTPKVTERGEDYMKAELTATELYGHIDKLVLKIKENNSNVITSQKVTVDASQLTKDGQVEVKFNSLSSDKEYIIEMEELIVDGKNVTDDGWYFISSTLKAKPTIEGLNLSYSTDKGEFVASPVNLVDRDESITSLEDDYKVNGSNAKEYAYSVVDANQKKTAVKVGRTVDMNDNGQSDYTFATPASNSVVVGKKTKPTVEFSLKEAEQD..... 676
55 -17.400IDP92676 gene: rne; ribonuclease E [Pseudomonas aeruginosa PAO1] NP_251666 [Pseudomonas aeruginosa PAO1]  ali follow..  237................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EALNFIRQVMPQYASKVKLYQDSVPLFNRFQIESQIETAFQREVKL-----------------------------IDPTEALVSIDIN-RATKGGDIEETALQT-----NLEAAEEIARQLRLRDIGGLIVIDFIDM------PAKNQRAVEERVREALEADRAREMSRQRLRPSLGETSGIVCPRCNGQGIIRDVESLSLAILRLIEEEALKDRTAEVRARVPFQVAAFLLNEKRNAITKIELRTRARIFILPDDHLETPHFEVQRLRDDSPELVAGQTSYEMATVEHEEAQPVSSTRTLVRQEAAVKTVAPQQPAPQHTEAPVEPAKPMPEPSLFQGLVKSLVGLFAGKDQPAAKPAETSKPAAERQTRQDERRNGRQQNRRRDGRDGNRRDEERKPREERAERQPREERAERPNREERSERRREERAERPAREERQPREGREERAERTPREERQPREGREGREERSERRREERAERPAREERQPREGREERAERPAREERQPREDRQARDAAALEAEALPNDESLEQDEQDDTDGERPRRRSRGQRRRSNRRERQREVSGELEGSEATDNAAAPLNTVAAAAAAGIAVASEAVEANVEQAPATTSEAASETTASDETDASTSEAVETQGADSEANTGETADIEAPVTVSVVRDEADQSTLLVAQATEEAPFASESVESREDAESAVQPATEAAEEVAAPVPVEVAAPSEPAATEEPTPAIAAVPANATGRALNDPREKRRLQREAERLAREAAAAAEAAAQAAPAVEEIPAVASEEASAQEEPAAPQAEEITQADVPSQADEAQEAVQAEPEASGEGAADTEHAKKTEESETSRPHA.............................. 1057
56 -17.400IDP91750 SPG2_STRSG [Streptococcus sp. `group G`]  ali follow..  19....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ASVSAAFLVGSTVFAVDSPIEDTPIIRNGGELTNLLGNSETTLALRNEESATAD------LTAAAVADTVAAAAAENAGAAAWEAAAAADALAKAKADALKEFNKYGVSDYYKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEMVTEVPGDAPTEPEKPEASIPLVPLTPATPIAKDDAKKDDTKKEDAKKPEAKKEDAKKAETLPTTGEGSTAAALAVMAGA-ASKRKED..... 593
57 -17.300IDP00824 IgG-binding protein SBI SACOL2418 [Staphylococcus aureus subsp. aureus COL]  ali follow..  26.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EAKASENTQQTSTKHQTTQNNYVTDQQKAFYQVLHLKGITEEQRNQYIKTLREHPERAQEVFSESLKDSKNPDRRVAQQNAFYNVLKNDNLTEQEKNNYIAQIKENPDRSQQVWVESVQSSKAKERQNIENADKAIKDFQDNKAPHDKSAAYEANSKLPKDLRDKNNRFVEKVSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEKKVAPKVEAPQIQSPQIEKPKVESPKVEVPQIQSPKVEVPQSKLLGYYQSLKDSFNY--GYKYLTDTYKSYKEKYDTAKYYYNTYYKYKGAIDQTVLTVLGSGSKSYIQPLKVDDKNGYLAKSYAQVRNYVTESINTGK-QNPTLVKTAIKAQETASSIKNTLSN............. 430
58 -17.200IDP92678 gene: rne; ribonuclease E [Yersinia pestis KIM10+] NP_669066 [Yersinia pestis KIM10+]  ali follow..  349..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DMTPVRHQREVENRLRDAVRQDRARIQI---------------SRFGLLEMS------------------RQRLSPSLGESSH--------TVRDNESLSLSILRLIEEEALKENTHEVHAIVSVNAIEKRQGGVRAVIVP-YSVLRVRKGEEVPSLSYLLPQLHEAEMAQPLEEATIERKRPEQPALATFSLPTEVPPEEAPTVAKAKPAVATPAAVSTDVEQPGFFSRLFSGLKNMFGASAEAEVQPAEVVKTDTSENRRNDRRNPRRQNNGRKERNDRTPREGRDNSSRDNTNRDNTSRDNANRDGANRDNSNRDNSGRDNVSREGREDQRRNNRRPAQPTTTSQGQTEVVEADKAQREEQPQRRGDRQRRRQDEKRQAPQEIKADVAEAPVIEEVQPEQEERQQVMQRRQRRQLNQKVRIQSANDELNTLESPVSAPVAQVVVAEVQEEVKLLPQITAQTDDDSANERTTNNENGMPRRSRRSPRHLRVSGQRRRRYRDERYPAQSAMPLAGAFASPEMASGKVWVRYPVTPVVEQVVVEQIAIEQTTTVEQTAIVEQVSVANIVTAQLPVEQVQNTVAEQESSATPSVMTTPTVAVATAAVTLAPQHKPGGSSSSAAAVPGRAPIVAAVPVVAETTAAETVVAKTEAAIDAVAVVEPMAAVESIAAVETATVEPVVTEEPNVTEPAVAEPAIETDPVEETTSVVEIAPTVEPTPMIEDTAVVVAATVVDTTPETASTQDDIVEETAVEAVNISETVAEETAITEPAAEAIATQQTTIAQETIAEPTVETAIDVVAVVKQPAVAHPEGVVFKHFASAPMTKAESPTKGHWERPTFDFSGKGSAGGHAAATQATAPATKPQSVE..... 1216
59 -16.800CPX_91702_91677 Complex of EZRI_HUMAN with M1_I34A1 [Undefined organism]  ali follow..  315.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................QKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEALXMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADS----QHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA-----EAMEVASQARQMQAMRTIGTHPSSSAGLKNDLLENLQAYQKRM-G.. 832
60 -16.700IDP91679 gene: vIRF-3; vIRF-3 [Human herpesvirus 8] HHV8GK18_gp64 [Human herpesvirus 8]  ali follow..  135............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EILYQHSVRLEKHRRRPRPFVGENSDSSEEDHPAFCDVPVTQTGAESEDSGDEGPSTRHSASGVQPVDDANADSPGSGDEGPSTRHSDSQPPPADETTVHTDNVEDDLTLLDKESACALMYHVGQEMDMLMRAMCDEDLFDLLGIPEDVIATSQPGGDTDASGVVTEGSIAASAVGAGVEDAGALEAQNVAGEYVLEISDEEVDDGAGLPPASRRRPVVGEFLWDDGPRRHERPTTRRIRHRKLRSAYYRVARPPVMITDRLGGR. 408
61 -16.500IDP05538 putative collagen-binding surface protein [Clostridium difficile 630] CD3392 [Peptoclostridium difficile 630]  ali follow..  223................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AGATYGVLATLTTDKNGNTDVIEVKAGTVYIKELSAPAGYKVDKTIYPLTIKAGETATLKVSDTPKVTDTLVELFKIDMETQKDNPQGNASLAGAEYYAGFYNKDNLPAEATRTWVTKTIAETDSDGTTHYITKLADAYKVSGDSFYMQDGKAVLP-EETKAPNGYLLDGAYMQAGDKSEQIKGLYLTQITEDGDLAVLTGSNQFSVSDKVIRGGVKIQKRDLETGDTKPQGSAT-----------KDTAFDIISLNDNAVLVEGKLYKKNEVVKTIHTDLEGVASTSADLLPYGKFRIVESEAPDGYLTDGAKPIDFAITENGKIVDLTDEAHSIYNQIKRGDIEGVKIGAGTHKRLADVPFRITSKTTGESHVVVTDDNGQFSTSADWASHKHNTNAGKTSEDGVWFGASEPDDSKGALPYDAYIIEELKCESNKGFELIPPFEIVVSRNNLVIDLGTLTDEYEKEISIHTTATSKDGEKTILAGKEVTIVDTVKLDGLTKGTKYQLKGWQMLKEENAELIIDGKRVENDYTFIADEEEMKVEISYTFNASALGGKNLVTFEELYDLSNPDEPVKVAEHKDIEDDGQTVLITERIIKIHTTATDKDGNKELEAGKDVTIIDTVTLEGLEVGTQYKLVGWQMLKEENAELLVNGKRVESDYTFIAD-SENMKVEVAFTFDATSLDGKQLVTFEELYDLSNTDEPKKVTEHKDIEDEGQTITFKEKPEVPEKPEQPQTPEKPSRPSDSPKTGDIVMLL 994
62 -16.500IDP06021 hypothetical protein TGME49_078860 [Toxoplasma gondii ME49] XP_002370589 [Toxoplasma gondii ME49]  ali follow..  2..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AAAPPSRYTRLTVEIEHCVDCEDHLHCTHHDGRKYEEYAKRVQESISHAVDEQLVLLVNPPPDLGRRGDLRCQEDRFCNHFYVIRDIKGMIVRKFRYPELGAFEVYLHNPFTNQKLTQSPLSPAEGPAVVSPLSSPQGESGAAATEAGSGAEGLQKEDKKSESATSSFDGGEEKKKTKKKKKGDSKAERYTDLTANVDDSEAPMEKKKKKKKKNGESDSADAVEGAPLETGREKEKKKAEHRFEAEAIESEGGKKKKKDCPPASAPGSEADDGQQTEDAQERLGKSVSEEERKKNKGEKKEKSEKKEKSEKKEKSEKKEKSEKKEKSEKKEKSEKKEKSEKKEKSEKKEKSEKKKDGANSELSAGSEGEDARKKKKKKEASRGTSLSGSDDGRKKKSGE..... 400
63 -16.500IDP93878 serine rich protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007690 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  275...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ENKTQIIATLTLAPDAAVSYNRSPLNSAPFIPAPDYDLETPSVNSNNAAQPGSVINNIKNITTTNNYYYGTPASIPNNISNTSGSDVTTQPEDNKPQSATATQTAVDTTDSSDQVSDEIDNSAQPKPLFVSSTALEPPVVKQDEPANYITTLDIQVNADETSPPADGLYRTVSAKVVAERHLNAQGSLLGTSGPIQSSITAAPKVTLTRGGQVRDLSQKQNDERGGSQQKSPSSVNTQGTSFAGLGENTSELLLAKSFLANKDAAVTLTQKGAQTRDLSQQSTYRLGGTQQKGPSSLTAQGNQFVGFGKNASVPTQSWSGNKDSNVTLTQAQTRDLSQKEDYRKSDTNAVNTGRSQLNKQP.............................................................. 637
64 -16.100IDP91543 cAMP-specific 3`,5`-cyclic phosphodiesterase, putative [Toxoplasma gondii ME49] TGME49_057080 [Toxoplasma gondii ME49]  ali follow..  11....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................QRSPPSAPSSTLLPGSAPEAKMLSCVDLERAGSDTVAPGPAGSDSVTSP-----------ADPFRDRFAVGRGSVLEHERCLRRRRSDSTADDTAMPEICVDKHRPSPKLTAASTLPRNAEDLHHGYHDVEAAGEPYGEMNNASEDRSSNSQFRLRCGRQAWETRPNSAAFVTALRALPWASALVHAPPVEHAPIQPSPGGGVPDAGANRCLHIDDTGATDNDSIRPPSLATIALSPSSSGSRSPHPDSIEGADFRLREVGTGGDSSPASSLESMSSPRSDETPRFLALVAVHGKPRPTNSPPAQASESCAGSGWREENRKSSAIRGSGRLSEVTANQRKTRSGQNSGQRNQGARKSLILSENLEGGLPARVPNRVDESDLELAVASPVSSVFHQSDSRGKRCCSKENEDSRGPQTRCIGSSKKLHVRQHRNGESAGDAGHAENPQEAEWRDSRTVTTPSKDAQLSGVNALHTVPRMHRKKGAKELPEPSSPLETCRDREAEKVAFCLSGADQGRQL-DPPGPIRRYVSRFLE-STYYDSFSGSRGDIDAVAHCFEGSVAADHQNAARRHTRSRSPAGCGRHRSSSADGCLVVAAHEAGASPRRGVFEGRHTHSQTFSLVKPASFQWATTQPLEQECASEADAKATANEEDQNHLRR. 696
65 -16.000IDP02214 hypothetical protein Cj0041 [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0041 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  3.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SNLAPQNDVLNLTPSKTSTTSSSFSKTSKNKEHE------SSDSKNSTQDDTESFLNSLLNSINETNEFLPDHMKISQKEVVNEAMSRLQKGAFDESDKISIFESASFMQILSLLDKLKTDTADVKLANLSTQLSSLIKTEANFNALKGASNLSELLDIAKDLGLNVKNIKVDRLLDLKATFPNLDKADFFKGAVDNVFKEIINNKISNVSKNLNHNLENTTHTTSTHSMQKTNSKDSGSLLSQTLKNLDSILSSKESKHEKNDKVKSKIEEDTTDAKNTLKNIKNDEFAKNLTEELNIKDKKNQDNLNKESKDLNKDFNKELNKNQEKNNLNQENIQDQNKNLKNNDQNLNLDKNLNKEIVKDTQKLVSNLTQKDFNLNKEPKNNNKENKDIKQNFFDQKLNFENLNKTQVVQNKENNANFNNNNTNNKETFTQEQTKTHSENVDKNSLDELNSLVKDLNKVTQNNARNITPKETLQYFSQDLKEAVDQYKA-PITKLSITLNPNNLGEVEVTLIQRGNNLHINFNSNANAMNLFIQNQAE-------KNSLVNMGFTGLEMNFSDQGKREQNQNQGKNRSGYGFKDALDGKNESEKVNLELV... 593
66 -16.000IDP05502 putative collagen-binding surface protein [Clostridium difficile 630] CD0386 [Peptoclostridium difficile 630]  ali follow..  218.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................GNYSIAGYGVFADKDCTKQLATLTTNENGNTDVVE---TVYIR-ELSAPAGYKVDKTVYSLKVEAGKTATLKVSDTPKVTDTLIELFKIDMETQKDNPQGNASLAGAEFTWKYYAGFYNKENLPAEATRTWVTKTIAETDSDGTTHYITKLADAYKVSGDSFYMQDGKAVLPLGTLTVEETKAPNGYLLDGAYMQAG--------------KSEQIKGLYVTQITEDGDLAVLSGSNQFSVSDKVIRGGVKIQKRDLETGDTKPQGSATLK-----------DTAFDIISLNDNVVLVEGKLYKKNEVVKTIHTDIEGVASTSADLLPYGKFRIVESEAPNGYLTDGAKPIDFAITENGKIVDLTDEAHSIYNQIKRGDIEGVKIGAGTHKRLADVPFRITSKTTGESHVVVTDDNGQFSTSADWASHKHNTNAGKTSEDGVWFGTSEPDDSKGALPYDTYIIEELRSDSNKGFELIPPFEIVVSRNNLVIDLGTLTDEYEKEISIHTTANSKDGEKTILAGKEVTIVDTVKLDGLTKGTKYQLKGWQMLKEENAELIIDGKRVENDYTFIADDEAMKVEIAYTFNASELGGKNLVTFEELYDLSNPDEPVKVAEHKDIADDGQTVLITERIIKIHTTATDKDGNKELEAGKEVTIIDTITLEGLEVGTQYKLVGWQMLKEENAELLINGKRVESDYTFTAD-SETMKVEVAFTFDATSLDGKQLVTFEELYDLSNPDEPKKVTEHKDIEDEGQTITFKEKPEVPEEPETPQTPEKPSRPSDSPKTGDLALLL 994
67 -15.800IDP05200 pepdidoglycan bound protein [Listeria monocytogenes EGD-e] lmo2714 [Listeria monocytogenes EGD-e]  ali follow..  19...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................PFSLAASAETNENGNNSTPTEEKTTDTTENIITEEKTEPAEPTKDTTVTPPQKSKVQTTIDITDSQEVYSYEQNSKIDLKDFTATLTDYTDTKLTNYRLAANSKLSTAQTGIQEVTLLGDNEDGKTTAVKLNYLVKEKTAQLTITDMNETKIFTGKTKPFASVYSSPADENFGEGTTTADKDGYFYAEWATTPKQITAYAFDESGNYSEEVTYQVPAKKQNEAVVTAPDKVKKIETKNAVKSATTKPTDVTKVTKDDKTDLPSTGDK 289
68 -15.700IDP91672 ARP4_STRPY [Streptococcus pyogenes]  ali follow..  2......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ARKDTNKQYSLRKLKTGTASVAVAVAVLGAGFANQTEVKAAEIKKPQADSAWNWPKEYNALLKENEELKVEREKYLSYADDKEKDPQYRALMGENQDLRKREGQYQDKIEELEKERKEKQERQEQLERQYQIEADKHYQEQQKKHQQEQQQLEAEKQKLAKDKQISDASRQGLSRDLEASRAAKKELEAEHQKLKEEKQISDASRQGLSRDLEASREAKKKVEADLAALTAEHQKLKEDKQISDASRQGLSRDLEASREAKKKVEADLAEANSKLQALEKLNKELEEGKKLSEKEKAELQARLEAEAKALKEQLAKQAEELAKLKGNQTPNAKVAPQANRSRSAMTQQKRTLPSTGETANPAATVMVSAGMLALKRKEE..... 385
69 -15.500IDP92672 gene: rne; ribonuclease E [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] YP_150903 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150]  ali follow..  251...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DFSSKIKLYTGEIPLFSHYQIESQIESAFQREVRL-----------------------------IDSTEALTAIDIN-RATRGGDIEETAFNT-----NLEAADEIARQLRLRDLGGLIVIDFIDM--------------PVRHQRAVENRLREAVRQDRARIQISHISRFGLLEMSRQRLSPSLGESSHHVCPRCSGTGTVRDNESLSLSILRLIEEEALKENTQE-LNEKRTAVNAIETRQNDQMETPHYSVLRVRKGEETPTLSYMLPKLHEEAMALPSEEEYAERKRPEQPALATFAMPDVPPAPTPVEPAVSVATAKKDNVAAEQPAQPGLFSRFLNALKQLFSGEETKTVETAAPKAEEKAERQQDRRKPRQNNRRDRNERRDTRDNRAGRDGGESRDDNRRNRRQAQQQNAEARDTRQQETAEKVKTGDEQQQTPRRERSRRRNDDKRQAQQEVKALNREEQPVQETEQEERVQQVQPRRKQRQLNQKVRFTNSTVVETVDTPVVVDEPRPVENVEQPVPAPRTELAKVDLPVVADIAPEQDDSVEPRDNTGMPRRSRRSPRHLRVSGQRRRRYRDERYPTQSPMPLTVACASPEMASGKVWIRYPIVRPQETQVVEEQREADLALPQPVVAEPQVI-------------------AATVALEPQASVQAVENVAVEPQTVAEPQAPEVVKVETTHPEVIAAPVDEQPQLIAESDTPEAQEVIADAEPVAETADASITVAENVADVVVVEPEEETKAEAAVVEHTAEETVIAPAQVVEKPQDVVCVDDHNHASAPMTRAPAPEYVPETPHHSDWQRPSFHFEGKGAAGGHSATRHASAPATRPQPVE..... 1067
70 -15.500IDP92670 gene: rne; ribonuclease E [Vibrio cholerae O395] YP_002820373 [Vibrio cholerae O395]  ali follow..  177.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AEELEWDLNVLLKHWSAIKQASDSHQESNVIVRAIRDYLR-IGEILIDSNSIYERALEHIRLVRPDFVNRV--------------YEGEVPLFSHFQIESQIESAFQREVRLPSGGSI------IDPTEALTSIDINSARATKGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENRLREAVRVDRARVQIGRISR---EMSRQRLSPSLAEASHHVIRDNESLALSVLRLIEEEALKDNTSQLLNEKRRSINHIEKAQQVRITIVPNSDMETPHFEVIRVREGEEQDVLSYLIPKKLEAMKEAEGKEVVDVELKPKRIEEPVLKGFAAPAEAVPAPTPKPKAEPQPVAEVQQPAQPGFFSRVFKAIASLFSATPEAAKVEAPVTQNSEQDKPRRERNDRNNDRRRNPRDKNRRRGNEENNERNDKETSNSNRKPQERKPKQERGERNERNDRNERPETERPERQDRRNKRDESKTAKLLEQGRQLAAEAQQEVKAVEPKEEKAAVVKERRQRRKLSKQIRVKDQLAAEELDNLSTAPVDNAFDAPAPVNLPVTDDFADSAQEDNEQDDQKQRRNRRSPRHLRASGQRRRRGRDRRPNPFRLRKGGVASPEMAMGKVMPRYDLAPRPQSRHETAEGAQHVTHVTPTAATAVVESEKVA-APRVLGGVAFPEMAMGKVIVRRETAAVQPEPVVQEPVITDVIAETLIAPVEPVVVEATVIEAPVIEESATETAALETVVAKVAEVEEPATISDEVVAQTTVEVIADKMAEPIKVVKPVTVSATSLTAKAVIQQPYASSPMTKAPGSDDIREVQVNAAPLRAERYQARGAGSQVVRNQASAGMSK..... 1048
71 -15.200IDP05007 putative lipoprotein [Bacillus anthracis str. Ames] BA_3383 [Bacillus anthracis str. Ames]  ali follow..  4...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KKVAIASITIGTMLTMAACSPSADKETDKKEQVTAQNEGEVKTTSTDETSKTTKDTDKETNTSSNEKTDKDAKNTKESSGTESNGKTSTQNENVKTKEKETTGKTNDQTTSGKTTDQSTSTNSDGKTTKDPKKSVAVKTSVKEVAALVDSLDKQLAANPKLETVNKLGKQINAKWDVIEKELETSHPAEYKTIGQSMYPLIVGAEKEKIDITKMKSLTTKTKKDLN..... 229
72 -15.200IDP92677 gene: rne; RNase E [Shigella flexneri 2a str. 2457T] AAP16595 [Shigella flexneri 2a str. 2457T]  ali follow..  174.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AEALQWDLSFRLKHWEAIKKAAESHQESNVIVRAFRDYLRLIDNPKVLELARQHIAALGRPDFSSKIK-----------------YTGEIPLFSHYQIESQIESAFQREVRLPSGGSI------IDSTEALTAIDINSARATRGGDIEETAFNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRAVENRLREAVRQDRARIQISHISR---EMSRQRLSPSLGESSHHTVRDNESLSLSILRLIEEEALKENTQEVHAIVPVPIAS-LNEKRSAVNAIETRQDGVRCVIVPNDQMETPHHEEAMALPSEEEFAERKRPEQPALATFAMPDVPPAPTPAEPAATVVAPAPKAATATPAAPAQPGLLSRFFGALKALFSGGEEAKPTEQPTPKAEAKPERQQDRRKPRQSNRRDRNERRDTRSERTEGSDNREENRRNRRQAQQQTAETRESRQQAEVTEKARTTDEQQAPRRERSRRRNDDKRQAQQEAKALNVEEQSVQETEQEERVRPVQPRRKQRQLNQKVRYEQSVAEEAVVAPVVEETAAAEPIVQEAPAPRTELVKVPLPVVAQTAPEQQEENNADNRDNGGMPRRSRRSPRHLRVSGQRRRRYRDERYPTQSPMPLTVACASPELASGKVWIRYPIVRPQDVQVEEQREQEEVQVQPMVTEVPVAAAVEPVVSAPVVEEMAEVVEAPVPVAEPQPEVVETTHPEVIAAAVTEQPQVITESDVAVAQEVAEHAEPMVEPQEETADADIEEVAETAEVVVAEPEVVAQPAAPVVAEVAAEVETVAAVEPEITVEHNHATAPMTRAPAPEYVPEAPRHSDWQRPTFAFEGKGAAGGHTATHHASAARPQPVE..... 1060
73 -15.100IDP93904 gene: yscP; putative type III secretion protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001004080 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  2.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................NKITTRSPLEPEYQPLGKPHHDLQARVDFEQALLHNKDNRHPKEEPRRPVRPHDLGKKEGQKGDGLRAHAPLAATFQPGREVGLKPQHNHQNNHDFNLSPLAEGATNRKHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPFGHDELFVQQSPIDSAQPVQLNTKPTVQSLNPAADGAEVMIWSVGRDTLASIAKNQRDSRQKRLAEEPLPLHQEALPEVCPPAVSTTPDDHLVARWCATPVAEVAEKSARFPHKATVQSEQLDMTELADRSQHLTDGVDSSKDTIEPPRPEELLLPREETLPEMYSLSFTAPVITPGDHLLATMRATRLASVSEQLIQLAQRLAVELELRGGSSQVTQLHLNLPEL---GAI 383
74 -15.100IDP92066 gene: GAPDH2; apicoplast glyceraldehyde-3-phosphate dehydrogenase 2 [Toxoplasma gondii] ABO93620 [Toxoplasma gondii]  ali follow..  10  6....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................RSSVRLRTRFSSSLPLSHCLFLALFLF-----------------------SFDNFLPTSRSLNS--------------------------------FSV-------P----------AAALRLDGRDGPRPQTPETFSSSAFAEPSPESTPGACPLSSNDGELSLQQAEALLREEQTLATEYAQRAAGDVQQFTAAAQEAAARGDMSAAKELAAAAAASAAEAEDLAAYAQAVGETDPAVLRERAKE-EAERFEQEERRQRGGDAASSGTCSESSDAAFAPEFSDLRDLFFGACDATVSPDDLPSVPEALEKLAGLESDVQARGDQLDEKEKVVAEYLVAAQEAAVRHEEASRAFEDAKRNKKENLAAAAEKAALEAAAEYADLTTAAQLVTEEAEQESAKALADAVAAGDLRFAINQKIVNEAGPEARGKVPRALLAPKHVRISDPAAGRVLKIFFHNNFAPFEDLPADAHLCRQHPRCVVQVEQSGDEVLQRCLLDEAYLALLTKTPDFCAAAPAEAETGLGNSAAQATGTPVSPFAGAAPLEPMAAVTEGEIEAVALDLLQESGVDGPAVLEH----MARDGRGSASDLCSLVQTLATELLQTERDPRCAAAPTSEDRENIALTTEALLTSAFGFLGPASPSATAATAATVASGTPQNARSASIRSHRRNSFAPTGKRAVAPVPRVSPTGLFGLLGSSSEKASAPIRLGING-RLVFRIAMSRPDVAVTHINCSMDPAYIAYMLKYDSVHGKFDGEIVPTETSTVSNTRDPEEIPWADYVCESTGVFCTTEAAAKHVNRPGGAKHAKDETTPTLVVGVNAEQDYESSMKVVSCASCTTN---LA... 804
75 -15.000IDP05536 putative serine-aspartate-rich surface anchored fibrinogen-binding protein [Clostridium difficile 630] CD3145 [Peptoclostridium difficile 630]  ali follow..  483....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ATTFKSLGGAVAYGDLEKKTKVFMNKISLKYLGQDKVSTTLVDDFKMLIDGKIYPYGAPSYTDDQGVLYLWFSDQFKGSEVSVNLVVIDKITGGNIKPDDFYVKDIGSGSQFLKQYEEFTIDDTPPYLIIKRYDGLPFEEDVEKLFLDWILKDGGIPIITPKGEKLTDKKFMTISSQRLNEETMEPDTNLGSDDLTKQVDAGKYQLSITSTQFSNVYPFNEAYWGHRAYYKAEIIPADTETSLVVEESKAKTDVFKPTDTFTLNVTISPDKKEGTDCASPRGYVQFYINGKEYKDPVELKTHNKGSESHNYSTASIEWRPLDSNHHIFTTEQTITVKYIGDDINYIEGSEDEKKNVDVDGDGIPDINIDTDGDGRPDINIDTSGDWKPDINIDTDNTKPSTEGGNGDGIWKPDKNIDTNGDGNPDTDYNRPAIDTDNDGVDDYWKPDKNVDTGSGGYDTGNPNLNKPDPDNGGNSKPDPDNGGNSKPDSGNGGNSKPDSGNGGNSKPDSGNGGNSKPDSGNGGNSKPDPDNGGNSKPDPDNGGNGKPD-----PDNGGNSKPDPDNGGNSKPDPDNGGNSKPDIDTDGDGKPNINIDTDGDGKPDINIDTDGDGKPDINIDIDGDGKPDINIDTDGDGKPDINIDTDGNGKPDINIDTDESLDSNVGQNVQTGDQSNIMLDLALM..... 1171

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.