current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP91685 gene: COL1A2; collagen alpha-2(I) chain precursor [Homo sapiens] NP_000080 [Homo sapiens], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980    .  990    . 1000    . 1010    . 1020    . 1030    . 1040    . 1050    . 1060    . 1070    . 1080    . 1090    . 1100    . 1110    . 1120    . 1130    . 1140    . 1150    . 1160    . 1170    . 1180    . 1190    . 1200    . 1210    . 1220    . 1230    . 1240    . 1250    . 1260    . 1270    . 1280    . 1290    . 1300    . 1310    . 1320    . 1330    . 1340    . 1350    . 1360    .
# Score Template Links and tools%idFirst MLSFVDTRTLLLLAVTLCLATCQSLQEETVRKGPAGDRGPRGERGPPGPPGRDGEDGPTGPPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATGDRGEAGAAGPAGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGAKGPKGENGVVGPTGPVGAAGPAGPNGPPGPAGSRGDGGPPGMTGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFKLast
1 -147.000IDP91685 gene: COL1A2; collagen alpha-2(I) chain precursor [Homo sapiens] NP_000080 [Homo sapiens]  ali  100  1MLSFVDTRTLLLLAVTLCLATCQSLQEETVRKGPAGDRGPRGERGPPGPPGRDGEDGPTGPPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATGDRGEAGAAGPAGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGAKGPKGENGVVGPTGPVGAAGPAGPNGPPGPAGSRGDGGPPGMTGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK 1366
2 -67.500IDP05192 gene: bclA1; putative exosporium glycoprotein [Clostridium difficile 630] CD0332 [Peptoclostridium difficile 630]  ali follow..  25  25............................................................................................................................................................................................................................................................................................................................................................................................................NLDYCLIGSKCSNSFVKEKLITFFKVRIPDILKDKSILKAELFIHIDSNKNHIFKEKVDIEIKRISEYYNLRTITWNDRVSMENIRGYLPIGISDTSNYICLNITGTIKAWAMNKYPNYGLALSLNYPYQILEFTSSRGCNK--PYILVTFEDRIIDNCYPKCECPPIRITGPMGPRGATGSTGPMGVTGPTGSTGATGSIGPTGPTGNTGATGSIGPTGVTGPTGSTGATGSIGPTGVTGPTGNTGVTGSIGPTGATGPTGNTGVTGSIGPTGVTGPTGNTGEIGPTGATGPTGVTGSIGPTGATGPTGEIGPTGATGATGSIGPTGATGPTGATGVTGEIGPTGEIGPTGATGPTGVTGSIGPTGATGPTGATGEIGPTGATGPTGVTGSIGPTGATGPTGATGEIGPTGATGPTGVTGEIGPTGATGPTGNTGVTGEIGPTGATGPTGNTGVTGEIGPTGATGPTGVTGEIGPTGNTGATGSIGPTGVTGPTGATGSIGPTGATGATGVTGPTGPTGATGNSSQPVANFLVNAPSPQTLNNGDAITGWQTIIGNSSSITVDTNGTFTVQENGVYYIS-VSVALQPGSSSINQYSFAILFPILGGKDLAGLTTEPGGGGVLSGYFAGFLFGGTTFTINNFSSTTVGIRNGQSAGTAATLTIFRIADTV............................................................................................................................................................................................................................................................................................................ 691
3 -57.000IDP05216 gene: bclA3; putative exosporium glycoprotein [Clostridium difficile 630] CD3349 [Peptoclostridium difficile 630]  ali follow..  29  1..................................................................................................................................................................................................................................................................................................................................................................................................................................................MSRNKYFGPFDDNDYNNGYDKYDDCNNGRDDYNSCDCHHCCPPSCVGPTGPMGPRGRTGPTGPTGPTGGVGATGPTGPTGPTGPTGNTGNTGATGLRGPTGATGATGPTGATGAIGFGV-TGPTGPTGATGATGADGVTGPTGPTGATGADGITGPTGATGATGFGVTGPTGP--TGATGVGVTGATGLIGPTGATGTPGATGPTGAIGATG-IGITGPTGATGATGADGATGVTGPTGPTGATGADGVTGPTGATGATGIGITGPTPTGATGIGITGATGLIGPTGATGTPGATGPTGATGPTG-VGVTGATGATGATGADGATGVTGPTGATGATGANGLVGPTGATGAAGTPGATGPTGATGPTG-VGITGATGATGATGPTGADGATGPTGATGNTGADGVAGPTGATGNTGADGATGPTGATGATGADGATGPTGATGATGVAGATGATGPTGATGADGATGPTGATGATGADGATGPTGATGATGVTGATGPTGPTGATGATGATGASAIIPFASGIPLSLTTIAGGLVGTPGFVGFGSSAP--GLSIVGGVIDLTNAAGTLTNFAFSMPRDGTI-TSISAYFSTTAALSLVGSTITITATLYQSTAPNNSFTAVPGATVTLAPPLTGILSVGSISSGIVTGLNIAATAQTPD................................................................................................................................................................................................................................................................................. 652
4 -56.200IDP05644 gene: bclA2; exosporium glycoprotein [Clostridium difficile 630] CD3230 [Peptoclostridium difficile 630]  ali follow..  34  2.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SDISGPSLYQDVGPTGPTGATGPTGPTGPRGATGATGANGITGPTGNTGATGANGITGPTGNMGATGPNGTTGSTGPTGNTGATGANGITGPTGNTGATGANGITGPTGNKGATGANGITGSTGPTGNTGATGANGITGPTGNTGATGATGPTGLTGATGATGANGITGPTGNTGATGANGVTGATGPTGNTGATGPTGSIGATGATGTTGATGPIGATGATGADGEVGPTGAVGATGPDGLVGPTGPTGPTGATGANGLVGPTGPTGATGANGLVGPTGATGATGVAGAIGPTGAVGATGPTGADGAVGPTGATGATGANGATGPTGAVGATGANGVAGPIGPTGPTGENGVAGATGATGATGANGATGPTGAVGATGANGVAGAIGPTGPTGANGATGATGATGATGANGATGPTGATGATGVLAANNAQFTVSSSSLVNNTLVTFNSSFINGTNITFPTSSTINLAVGGIYNVSFGIRATLSLAGFMSITTNFNGVTQNNFIAKAVNTLTSSDVSVS............................................................................................................................................................................................................................................................................................. 521
5 -46.700IDP05605 collagen triple helix repeat domain protein [Bacillus anthracis str. Ames] BA_4978 [Bacillus anthracis str. Ames]  ali follow..  27  2.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EGNGGKSKIKSPLNSNFKILSDLVGPTFPPVPTGMTGITGSTGATGNTGPTGETGATGSAGITGSTGPTGNTGGTGSTGSTGNTGATGSTGVTGSTGVTGSTGVTGSTGVTGSTGPTGETGGTGSTGVTGSTGATGSTGVTGSTGVTGETGPTGSTGATGNTGPTGETGGTGSTGATGSTGVTGNTGPTGSTGVTGNTGATGETGPTGNTGATGNTGPTGETGVTGSTGPTGETGVTGSTGPTGNTGATGETGATGSTGVTGNTGSTGETGPTGSTGPTGSTGATGVTGNTGPTGSTGATGATGSTGPTGSTGTTGNTGVTGDTGPTGATGVSTTATYAFANNTSGSVISVLLGGTNIPLPNNQNIGPGITVSGGNTVFTVANAGNYYIAYTINLTAGLLVSSRITVNGSPLAGTINSPTVATGSFSATIIASLPAGAAVSLQLFGVVALATLSTATPGATLT.................................................................................................................................................................................................................................................................................................................................................................................................................. 464
6 -35.600CPX_91685_91738 Complex of CO1A2_HUMAN with Q5YB85_STRSG [Undefined organism]  ali follow..  95  1MLSFVDTRTLLLLAVTLCLATCQSLQEETVRKGPAGDRGPRGERGPPGPPGRDGEDGPTGPPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATGDRGEAGAAGPAGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGAKGPKGENGVVGPTGPVGAAGPAGPNGPPGPAGSRGDGGPPGMTGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIESRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPE-------NIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK 1366
7 -28.300IDP05143 triple helix repeat-containing collagen [Bacillus anthracis str. Sterne] BAS4423 [Bacillus anthracis str. Sterne]  ali follow..  25  3.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SWRNNINGYCSCNNQNGVHVDSCCFSCDGTVPKLGPTGPTGATGATGATGVTGVTGVTGATGITGATGITGATGITGVTGPTGATGITGATGATGPTGATGPTGATGITGATGATGATGATGVTGVTGATGITGATGITGVTGPTGATGITGATGPTGATGITGATGPTGVTGTSITATYAFANNTSGTAISVLLGGTNVPLPNNQNIGPGITVSGGNTVFTVANAGNYYISYTINITASLLVSSRITINGAPLAGTINSPAVATTSFSATIITTLAA......................................................................................................................................................................................................................................................................................................... 280
8 -24.200IDP91911 G5 domain family protein, partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005012 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  13  1............................................................................................................................................................NIKGPKGDKGADGAKGEKGDQGERGLTGAQGAKGADGAVGRDGRDGKDVLNGKANPEAHQGKDGDKYVNTETGDVFVKNNGNWDKEGNIKGPKGDKGERGEDGKTPEVTVTPGKDGHSTVPGKDPVTVNVKDGENGLNGKTPKVDLLRVQGKNGNPSHTIVTFYTDENN-DGKYTPGTDELLGSEMIKDGAKGADGRDGKSLLTVKDGKETKVYQED-PANPGQPLNPEKPLAVIRDGVDGKSPTAVRKDEAGHKGVEITVDNHDGSQPTTVFVQDGAKGETGAIGQDGQTPTITTQRGQDGQSTVVTITTPGKDPVT-FTVKDGKNGKDGRAPKIKVEDITSPSRIRRATDAAATPTRNGIRVTVYDDVNDN--GVYDGGVDKVLNSKDIYNGIDGRDGSAPT--KDNGDGTHTITVQNPDGSESTTVVKDGKDGKTANENPDGSHTITVTNPDGSTKETVVKNGKDGKTPTDNNDGTHTVKVTDGDGNVTNAIIKDGKDGKAATENPDGSHTVTITNPDGTKNEFVVKNGRDGVDGRTPTASRDNGDGSHTIVITNPEGVTTETTVRDGKSPKTITDEQNGTHKISVLNGDGTTTETIIKDGKSPRDNQDGTYTIRVENGNGTVSETTVRDGKSPTA-VDNGDGTHTITVVNSDGTTTTTTVRYGREPKLEVIDNNDGSHTIKVTGADGKETTTTIFDGKSPKANIVDNG-DGTHTLTIVDSDGREYKSIIKDGKDGKDGVSNNDGTHVVTITNPDGSKTEMVIKDGKDGKSPKDNGDGSHTITIINSDGTVTKTVIKDGKDGRDGRDGRDGKDGKCGCQDKPVTPSNDKPVPPAPNVPTPEVLVKPVPAQPTPNVPTPEVPVQPTPAVPTPEVPVPEQPVVPTPAQPATPVNANPVAPTTGKENRGDKLPETGSQS................................................................................................................................................................................................................................................................................................... 951
9 -12.400IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1294........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AGHEGADNGAEDKQGAEGNEEEHGDAAAAAVAEESVSAEAVQGDEEPKKVVKKGAVPRVKKRSYDQVEGTEVAAIAIERDFFTEAEAPDFKNLMSDVEHAINTHLGLSPGRVRAFQARYAEKRIVFAVGPPMDDATEADAVSSVALMEKLRDILPSMAHEEGRFQEVTGGGATLQWDGPGTNILDRIAQEQATAGEGEQQTSEGIPTRDMQVDGTAVLEEAGEKSDKKKKKKEKKEKKEKKEKKEKKEKKEKKKKKGGETAAEPEEASAVLAPPPVPVPAAAIPSVLLPADSEDGEKEQPKEKKKEKKEKKKKKDGETDAEPEEASAVLAPPPVPVPAAAIPSILLPTDGEDGEKEKTKEKKTEKKKEKHTEKKHKKKSEALPESETTAVVTVTPGEE-DETSPLVPVPSSIASSEAPEPPASTRVTPAPEPKAKPGLSMGAALLAVRARSRLQRKHLAQQLSSSSSSEVSASSASSLSPSSSSSSDFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENTRLAATRRRDDKLQRQVEAERERAVELLKEATRRAKEEKDLIARQPPPARDWSDTVVLSTPQI------FVNSQAACAPFADSG---------------RDEGGRDEWYEVSDACSRRAESSNESRTTAGAKLRQQQLDLAGRT............................... 1990
10 -7.500IDP91542 3`,5`-cyclic phosphodiesterase, putative [Toxoplasma gondii ME49] TGME49_080410 [Toxoplasma gondii ME49]  ali follow..  1.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MAAESSPSGPIESAGLAARDESP-TRSSTSSLDPDQQTCEHASSLPSLRESPRASASSSGVASKAG-EGPRLLTFLPQRLHEATPPQDGALPAASGHGHTDAETHAQGAN--PGEARPEIQAGPDSDSKTSSSP-SLAVASKQKAHAEGVSSHASSISGKRRAQGVEKLSVGSSKTALVSLDEESDVSGADSAASVLSSQWASGEDRTIGAKPVPDRARWTTTAHDATT-----HGDASAETLTTPEGIQSPPLSCIVAVEEQTVPPWEERGIVEGVGVVKASSLKKSGRGPKAIHFREADSEVSAPSFSDMPSLGPGMGRQESDLERRSNGEVFRPMHFSEDDEEEDEEETKRYLGRSQTGDPGWRGLRWQMRSMWRYVAAINNDEATMKNATGPYRVLRGCDCKCFPLAFKERRAECDY........ 416

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.