current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|16128000|ref|NP_414547.1| conserved protein, UPF0246 family (yaaA b0006 exp) [Escherichia coli str. K-12 substr. MG1655], from E.coli

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQISTLMRISDKLAGINAARFHDWQPDFTPANARQAILAFKGDVYTGLQAETFSEDDFDFAQQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQGDNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIENRLTKPEQLTGFNSEGYFFDEDSSSNGELVFKRYEQRLast
1 -111.000[S] COG3022 Uncharacterized protein conserved in bacteria  ali follow..  99  1MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQISTLMRISDKLAGINAARFHDWQPDFTPENARQAILAFKGDVYTGLQAETFSEDDFDFAQQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQGDNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIENRLTKPEQLTGFNSEGYFFDEASSSNGELVFKRYEQR 258
2 -5.810[O] COG3555 Aspartyl/asparaginyl beta-hydroxylase and related dioxygenases  ali follow..  52......................NRPYLAPQTFPELQVLVDNWQAIRSEALHLHDAGNIKRSEQYDDIGFNSFFKSGWKRFYLKWDEAHP--SAGQLCPQTTALLRQIPSVKAAMFAELPPGSKLVRHRFHLGLFTPNDPACFIEYHWRD-FDETFIHYAENATEHLFCDIERPLTQGW................................................................................ 227
3 -5.360[R] COG1090 Predicted nucleoside-diphosphate sugar epimerase  ali follow..  10  114......................................ERWTEAYKAEIFDSRKLGTEKLVEAIAKADRKPQVMISGSAIGYYPGDDFLAEVCQAWENAAHQVEQLGVRLVVFRIGIVLGADMLPPFKLFAGGPL---GSGEQWFSW-RDLIALIDKALTDSTLRGTYNATAPNPVKMKEFCHTLGKVL------ARPSWLPVPDIALELLLGEGAKLVLEGQEVLPGAISK---TDFQFQ................. 325
4 -5.150[J] COG1549 Queuine tRNA-ribosyltransferases, contain PUA domain  ali follow..  12  256...................HSMTRPEVIRWKKRVKERFEPPAGIDLLLIFPCSAK---------KPYSRSRSHMLFRKAMKDALGEKLHRV---------------HELIVTSPYGVVREWEWLAKYDIVVTGHWSDEE---------KFAGELLASTLDKYPDVPIIAHVEGGYKEAVRYAMELTNRVIFTAVGDSTTSKDSLKKLEATLREFDVRDVDKEYRRYRFYENIRKVFDYYFGLGAGNE........... 453
5 -5.000[K] KOG4091 Transcription factor  ali follow..  10  1....MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQEDSSLPLDGETMCAATSPAVKLHDETLTYLNQGQSYE-IRMLDNRKMGDMPEINGKLVKSII-------------RVVFHDRRLQYTEHQQLEGWKWN-DRLLDLDIPMSVGIIDTRTNPSQLNAV-----IQVHCISTEFTPRKHGG----------EKGVPFRIQVDTFKQNENQIKVFKPKG---DRKQKTDREKMEKRTAHE 258
6 -4.940[V] KOG1717 Dual specificity phosphatase  ali follow..  11  214.................................................................................LYLGCAKDSTNLDVLEEFGIKYI---LNVTPNLPNLFENAGEFKYKQI----PISDHWSQNLSQFFPEAIS--FIDEARGKNCGVLVHCLAG---------SRSVTVTVAYLMQKLNLSMNDAYDIVKMKKS-----NISPNFNFMGQLLDFE........................ 344
7 -4.850[R] COG4710 Predicted DNA-binding protein with an HTH domain  ali follow..  12..............................................................................................................................................................................YYEYMHLSEGFDMATSIRLSPEMEQRLNYLASHTGRTKAYYLREIIEHGIEEMEDYYLAAD---VLERVRHGQEQVHSAADVRK 92
8 -4.830[S] COG4728 Uncharacterized protein conserved in bacteria  ali follow..  31  48..................................................................................YKGQNYRVLGVARHSET-----EEALVIYQALYG-VRPLEMF...................................................................................................................................... 88
9 -4.810[R] KOG2316 Predicted ATPase (PP-loop superfamily)  ali follow..  1MRVAALISGGKD-------SCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPTIRGRSLDTRQVYTKCEGDEVEDELLKLVKEKEEVEGISVGAI----LSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSEGGEYETFTLDCPLFKKKIISEVVIHSADAFAPVAYLRFLELHLEDKVSSVPD......... 256
10 -4.730[S] COG5607 Uncharacterized conserved protein  ali follow..  14  2...............................NSMAMVAQKVFSQQFARMLAHEKGTRKGEDIEELH-DMRVSIRRMRAAAKVFEAY---------LDSKKLGPHLKGLKSTLGALGDVRDLDVFREKAEGYLKKLPPEKEHDL-----DPLFAVLAEEREKSRKNMLIYLESEKYSSFKKE----------EDLADYEFWALPATTKKHDALPHRIRDVLPSILY--ARFADISAYSEWVEGPHVYVERLHRLRIAAK 203

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.