current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|238922434|ref|YP_002935947.1| DNA polymerase III, beta subunit (EUBREC_0002) [Eubacterium rectale ATCC 33656], from E.rectale

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370
# Score Template Links and tools%idFirst MKLICSKANLLKGVNIVSKAVPTRTTMAILECILIDASANEIKLMANDMELGIETIIDGTIEERGIIALDAKIFSEIVRKLPDNDVTIETDASFKTVISCEKAKFNIIGKSGDDFSYIPYVERNESIVLSQFTLKEVIRQTIFSIADNDNNKLMTGELFEIEENKLRVVSLDGHRISIRYIEMKNHYDSKKVVVPGKTLQEISKIIPGSADEDVVIYITNNHIVFEFENTTVVSRLIEGEYFKIDQMLSSDYDTKVRINKRELLDCIDRATLLVKEGDKKPIIMNITDGNMELRINSFIGSMNEDIDIDKDGKDIMIGFNPKFFIDALRVIDEEEVNLYMVNPKAPCFIKDDEGKFIYLILPVNFNTAANLast
1 -97.900IDP90614 DNA polymerase III subunit beta [Vibrio cholerae O1 biovar eltor str. N16961] VC0013 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  24  1MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLEGEEAGSITVPARKFLDICRGLPDSAVITVLLEGDRIQVRSGRSRFSLATLPASDFPNIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLRSVATDGHRMAVAQAQLGADFAQKQIIVPRKGVLELVKLLDAP-EQPVVLQIGHSNLRAEVNHFVFTSKLVDGRFPDYRRVLPQHTSKTLQTGCEELRQAFSRAAILSNE-KFRGVRVNLADNGMRITANPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRCDNVRVSMSDANASALVENDDDSAMYVVMPIRL..... 366
2 -93.600IDP04571 DNA polymerase III subunit beta [Bacillus anthracis str. Sterne] BAS0002 [Bacillus anthracis str. Sterne]  ali follow..  30  1MRFSIQKDYLVRSVQDVMKAVSFRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMTKITSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILTGVNWKVYNSELTCIATDSHRLALRKAKIEGIVDQANVVIPGKSLNELSKIL-DESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSLEQAMLEISSSPEIGKVVEEVQCEVDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTNDESIIQLILPVRT..... 378
3 -88.300IDP06076 gene: dnaN; DNA polymerase III subunit beta [Helicobacter pylori J99] NP_223170 [Helicobacter pylori J99]  ali follow..  20  1MKISVSKNDLENTLRYLQAFLDKKDASSIASHIHLEVIKEKLFLKASDSDIGLKSYISTQTDKEGVGTINGKKFLDIISCLKDSNIVLETKDDS-LVIKQNKSSFKLPMFDADEFPEFPVIDPKVSLEINAPFLVDAFKKIAPVIEQTSHKRELAGVLMQFKHQTLSVVGTDTKRLSYTQLEKISTEEDISCILPKRALLEILKLF----YENFSFKSDGMLAVVENETHAFFTKLIDGNYPDYQKILPKEYTSSFTLGKEEFKEGIKLCSSLSST-----IKLTLEKNNALFESDSEHSETAKTSVEIEKGKAFHLGVNAKFFLEALNALGTTQFVLKCNEPSSPFLIQEPLDEISTLMMPITL..... 374
4 -5.910IDP90779 gene: nusA; transcription elongation factor NusA [Yersinia pestis CO92] YPO3497 [Yersinia pestis CO92]  ali follow..  13  2......NKEILAVVEAVEKSLPREKIFEALETALATATKKKY--QEIEVRVSID-------RKTGDFDTFRRW--VAVDEVTMPTREITLDAAQFEDPSLQLGDYVEDQIESVTFDRITTQTAKQVIV---QKVREAERAMVVEQFRQYLGQIVTGIVKKVSRDSIAL----------------DLGHNAEAVIGREDMLPRENFRPGDRIRGVLYDVRPEQLFVSRSRSEMLVELFRIEVPEIGE------------------ELIEIKAAARDPGSRAKIAVKTNDKRID-ACVGMRGARVQAVSSELGGERIDI---AQFVINAMAPADVASIVVDEDKHTMDVAVEASN................. 313
5 -5.690IDP04602 transcription elongation factor NusA [Bacillus anthracis str. Sterne] BAS3667 [Bacillus anthracis str. Sterne]  ali follow..  14  2......STELLDALLVLEKGISKDIIIDAIEAALISAYKRNF--QAQNVRVSFN-------PQVGTIQVLARK--DVVDNVFDPRLEISVEEARQINPNYQDGDVLEIEVTPKDFGRIAAQTAKQVVT---QRVREAERGVIYSEFSDREEDIMVGIVQRQDARFIYV-----------------SLGKVEALLPVSEQMPNEQYKPHDRIRVFITKVEKTQIYVSRTHPGLLKRLFEMEVPEIYD------------------GTVEIRSVAREAGDRSKISVHAENIDVD-SCVGPKGQRVQRIVDELKGEKIDI---VEYVANALSPSQVVKVLVDEEEKATTVVVPDHQ................. 312
6 -4.640IDP06274 gene: nusA; transcription elongation factor NusA [Streptococcus pneumoniae TIGR4] NP_345069 [Streptococcus pneumoniae TIGR4]  ali follow..  12  2......SKEMLEAFRILDKGIKKEDIIDAVVESLRSAYRRRY--QSDSVAIDFN-------EKTGDFTVYTVR--EVVDEVFDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGRVAAQSAKQTIM---EKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYV-----------------NLGSIEAQLSKQDQIPGEVFASHDRIEVYVYKVEDNNVFVSRSHPEMIKRLMEQEIPEVYMSVAREAGDRTKVAVRSHNPNVDAIGTIVGGANIKKITSKFHPARYDAKNDRMV-PIEENIDVIEWVADPA-----EFIYNAIAPAEVDQVIFDENDSKRALVVVPDNKLSLAI........... 332
7 -4.430IDP05237 putative cellsurface protein [Listeria monocytogenes EGD-e] lmo1653 [Listeria monocytogenes EGD-e]  ali follow..  48.....................................................................................................................................................................................NPNEVVGDADYVFVGKVTQETGTDYKNETPIEQEDDSIKYIGEAYTNYKVEVISNLKNELAMDKEIIREDGSAYDVFEDDQLPEVGNIYIFTAYTQDDGSLLVAGGNSTISFDEKTKKIDTEKEVSKTEEFELYEEAVENQVTPE............................................ 199
8 -4.360IDP90599 gene: nusA; transcription elongation factor NusA [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0460 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  11  2.......EKIADIIESIEKNLNLENVREKVATALINTAKR---------IYGQEYEFFVDPKNLNLYQKITIVADNDERLQNKSESFIALSKAKSEAPDVEIGDELTYECSLENLGRTAVNTLHKELE---YHIQKLLEQTIFEKYKNKVGQMVFGTVVRVDNEENTFIEID----------------ELRAFLPRKNRIKGEKFKIGDVVKAVIRRVYTDKIELSRTSPKFLECLLEAEVPEIKD------------------GYVNIIGCARIPGERAKIILQANGTNID-ATVGVKGVRINAVSKELHNENIDC---EILISRALAPAIVNSVKIE............................... 298
9 -3.940IDP04566 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1876 [Clostridium perfringens ATCC 13124]  ali follow..  74STTEFSDSELTDLFI--LALREEPDAIKDLTGLKVDIENDDINIYVDNIPFQGKLTFTAQSKDGGFIDISKDTIFKNLQDNSILSFDKT-NGDIILSFKDIIKYLQIKSIKVEN-------KIVIVFNGTIPLLSSIFPN...................................................................................................................................................................................................................................... 219
10 -3.790IDP04720 hypothetical protein [Yersinia pestis CO92] YPO1174 [Yersinia pestis CO92]  ali follow..  3................................QVNNISTNNIHSAGFNNSNSIQKYTGAVSSISDDLRI-NNEKCKSDIGTISGDIKINRHSAVYGNVNSVSGDITVKNSIVD----KDITTVSGDVNAVNSTIGKNIKTV-------------SGIEVEQSTVSGNLETTSG-GIDIDTTKINGNVHTTSGSISMNDSTIDGSVTCKAGSVTIVNSTIKESLNVTSEKIIVGTASCIGKI------ISPPESVNFNIMNFGNDSIVMGMRNFCISGEVNF-KVFVNEQRVGHTASQSTSKKVEEVTINIAKNASVNDIVFYTKKCHIILEGNAKYNGEKKDGMQFTHVNAPKSH............... 306

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24