current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|238922442|ref|YP_002935955.1| putative oxidoreductase (EUBREC_0016) [Eubacterium rectale ATCC 33656], from E.rectale

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .
# Score Template Links and tools%idFirst MKQLNWATLGCGVIANELAHALSKEGRTLYSVANRTHEKAVAFAQKYGISKVYDNIDDVFYDPDVDIIYISTPHNTHINYLRKALSNGKHVLCEKSITLNIAELDEAVSLAKENNVILAEAMTIYHMPVYKKLNEIIASGQLGRLNLIQVNFGSYKDYNMTNRFFSRKLAGGALLDIGVYSLSLIRWFFKETPTQVSSQVKYAPTGVDEQAGILLMNDAVEMATVTLSLHSKQPKRATLSFDKAYVEIFEYPRGMQATITYTEDGHKEVIDAGDTSDALYYEVRDMEKAVSSASSDEIETLMHCQYTYDVMKIMSDIRAEWGMKYPEEELast
1 -55.200IDP02458 putative oxidoreductase [Yersinia pestis CO92] YPO2259 [Yersinia pestis CO92]  ali follow..  16  3.DKIKVGLLGYGYASKTFHAPLGTPGLELAGVSSSDASKVHA---DWPAIPVVSDPQMLFNDPSIDLIVIPTPNDTHFPLAQSALAAGKHVVVDKPFTVTLSQANALKEHADDAGLLLSVFHNRRWDSDFLTLKTLLAEGSLGNVVYFESHFDRYRPEIRQRWREQAGAGGGIWYDLGPHLLDQALQLFG-LPETLNVDLGMLRPGSVDYFHAVLSYPGQRVVLHSTVLAAAETARYIVHGTQGSYIKFGV-DMRDGIVTLSHDNVLTEKPLLTLPGNYPAYYAGIRDAIWGTA----PNPVPATEAIKVMELIELGIASD-LPIIAKN 349
2 -50.800IDP00126 gene: mviM; putative virulence protein NT01ST1449 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  1MRTLRIGIVGLGGIAQKAWLPVNTAGWTLQGAWSPSRDKALRICESWRIP-YVDSLANLASS--CDAVFVHSSTASHYAVVSELLNAGVHVCVDKPLAENLRDAERLVALAAQKKLTLMVGFNRRFAPLYRELKTRLGTAASLRMDKHRTD-------------VGPHDLRFTLLDDYLHVVDTALWLAGGEARLASGTLLTSES--GEMCYAEHHFSADKLQITTSMHRRSQRESVQAVTDGGLYDVTDMREWREERGQGILIKPIPSWQTTLEQRGFVGCARHFIDCVQNQT----VPETAGEQAILAQRVVEALWRDA........ 304
3 -49.500IDP95263 MviM protein [Acinetobacter baumannii ATCC 17978] YP_001083150 [Acinetobacter baumannii ATCC 17978]  ali follow..  12  2........................DVNDSVGIMDSHFPEAEFFTEFEEFEAYVE--DQKLKGEKLDYVAICSPNYLHAPHMKYALKNGIDVICEKPLVLNSEDLNMLAEYEKQYGAKVNSILQLRLHPSIIALRDKVQAAPADKVFDVDLTYLTSRGKW-KSWKGVDNKSGGVATNIGVHFYDMLHFIFG-KIVKNEVHYR-----DEKTASGYLEYERARVRWFLSIDANNLPENAVEKLTYRSITIEN-----EELEFSGGFTDLHTQSYQRVLEGKGYGVEENRAAIETVEVIRVSPIIENPENPHPL.................. 278
4 -48.600IDP05340 putative oxidoreductase [Clostridium difficile 630] CD3450 [Peptoclostridium difficile 630]  ali follow..  12  1MKNIKMGMIGLGSIAQKAYLPIKSERFEFVGAFTPNKVKREKICSDYRI-MPFDSIESLAKK--CDCIFLHSSTETHYEIIKILLNLGVHVYVDKPLASTVSQGEELIELSTKKNLNLMVGFNRRFCPMYKEIKNNA--TEIVSINICKHGLNSLRNVR----------FDSTLIDDYIHVIDTALWLANEDVEISGEDLFLTDNKNLIFVSHKLKGKNFSINTSMHRDSGTKLEQVEILSKGKIQRVKNLNVLEIEEGGNLTLKQSGAWVNILKQKGFEDISNHFIDCIENNI----KPAINGEECIKAQRLLEKIINSV........ 304
5 -48.600IDP91405 dehydrogenase [Vibrio vulnificus CMCP6] VV1_0801 [Vibrio vulnificus CMCP6]  ali follow..  11  3......WLIGSGLMSIDYAKVLDAQGCDY-QVVGRGSDSAASFTEKTGKAVICGGLAQHIANAVAEAAIVSVGVAQLYETTKQLIEAGKKILVEKPGATTLAEIEELRQLSEQHGCAVYIAYNRRFFSSVLEAQRLIEQEGGVTSFNFELT---EWAHVIEKIDKPQEVLNKWFLANSTHVADLAFYLGG-KPRDICCQGSLNWHQAGSVFSGAGMTEQGALFNYAANWESAGRWSVEVLTKENRYVFR-----PMEALQVQKRGTIPLVAVEVDDALDKEFKPGLFKQVEAFLGDDARLLCRLEEQCSLFPIYEKM............ 308
6 -40.400IDP00570 putative oxidoreductase YPO2042 [Yersinia pestis CO92]  ali follow..  14  234MKKLRVGIVGLGGIAQKAYLPIQAQGWQLVGAFSPNQAKAQPLCDSYRM-RYFSRLDTLAAA--SDAVFVHSSTASHFQVVHDLLQAGVHVYVDKPLAETREQSEQLIELADKQHLALMVGFNRRFAPLYQQLKQQASSPVSLRMEKHRLS-------------IGPHDLGFTLLDDYLHVVDTALWLGG-EGARLTGGAVQTNAQGQ-MLYAEHHFQQGGCLITTSMQAGTQRESVQVISDGACYHITDMRQWQQASAGQVISQPAPGWQTTLEQRGFTGAVHHFIEAVSNQT----RPQVSGEDAIVAQRMIERILQQ......... 536
7 -11.500IDP02253 gene: hom-1; homoserine dehydrogenase [Bacillus anthracis str. `Ames Ancestor`] GBAA1968 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  19  3.NVIHVGVLGLGTVGSGVVHILKEHYKKVKTVVVRDLEKERDV--CIDGIVVTCHVDEVLNDPNIDIVVVMGGIEEAKQHIVKALRNKKHVVTANK-DLMAVYGAELLQLANDNDCLCYEASVAGGIPVLRGLTDGLASDQIGTTNYMLTKMSQKGWSYEEALQEAQKLGSDPTADVDGLDAARKVAILANSLDDVQVRGIRKVEKEDLQMAEKLGFGSAIHLSVEPTLLPSHHPLSNVNNEFNAVYVHG............................................................................... 289
8 -8.330IDP90926 gene: aroE; shikimate 5-dehydrogenase [Salmonella typhimurium LT2] STM3859 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  17  127.......LRGSGGMAKAVACALKDAGFTRGYIVAIDEASGKQLAELYGY-----EWRPDTDGIEADLLINATPIGMAGGNDADKLSYSEQEVDKASVIFDVPPVTPLIRYARERGVFAIQALYTGIRPDDALFQKAAAWSRL........................................................................................................................................................................................... 272
9 -8.220IDP90792 gene: aroE; shikimate 5-dehydrogenase [Vibrio cholerae O1 biovar eltor str. N16961] VC0056 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  128.......LIGAGGAARGVLKPLLDQQPASITVTNRTFAKAEQLAELVAAYGEVKAQAFEQLKQSYDVIINSTSASLDGELPAIDPVIFSSRSVCYDMMYGKGYTV-FNQWARQHGMLVGQALWRGLRPGTKQILRELRKNLEGAL........................................................................................................................................................................................ 278
10 -8.190IDP06064 3-hydroxyacid dehydrogenase [Helicobacter pylori J99] NP_223303 [Helicobacter pylori J99]  ali follow..  16  1...MKIGWIGLGAMGTPMATRLRDAGLEVS-VYNRTESKAAPLKEK---VAVYTSPIDLAAKVDLVFTMLSDKAAIDAVLAPKFWEQMSKKIVVNMSTIAPLESLSLEKIAQKHQATYLEA------P----VSGSVGAAKAGALLILAA--GDEEVISKLKPVLAH---GSQTFYLGGAKLSINSLLAQMGVAYSEALLLAKRLGVDAESFLQIIGQSGMNSPL........................................................................................................ 211

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24