current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|238922451|ref|YP_002935964.1| hypothetical protein (EUBREC_0025) [Eubacterium rectale ATCC 33656], from E.rectale

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
# Score Template Links and tools%idFirst MEETGKAGKKSNIEINADKGAKQNSHPGREEWPHLIRIGVMVFVTFAVSILFFFALYRFEGFAGIWSKLLAAAMPIIMGLVLAYLMNPVMLWLERCFKKLLSKKMKSESKLRKVSRALAITGSVIILVAIISLLIAAIVPSVIASISGLMKTLPNDVAAFINMIKNGNFGDSKIAELASTGLQNATDYIENYATEKLIPEAQKYVAQITTGVISIVRGLFNFIIGIIVMVYVMSIQETLAGQSKKIIYAVCKPKTGNIIIETIRKTNEIFGGFISGKIIDSLIIGVIAYFGCLILRIPSSVLVAVIIGVTNVIPVFGPFIGAIPSLLIVVIQSPWHALYLLIFIVVLQQVDGNIIGPKILGSSTGLSTFWVMFAILIGGGMFGFLGMLLGVPTFAVIYYIVKRVVNYALRKKKLPEDTRDYTKTTGVDTKNNKLKYELast
1 -22.700sp|Q9H330|CI005_HUMAN Transmembrane protein C9orf5 OS=Homo sapiens GN=C9orf5 PE=1 SV=2 (Range: 601-900)  ali follow..  12  18....................................................................................................................................................................................SILESLWIVMSRNVSLLFTTVTTLLTILFYSGTALLNFVLSLIIFLTTLFYLLSSSDEYYKPVKWVISLTPLSQPGPSSNIIGQSVEEAIRGVFDASLKMAGFYGLYTWLTHTMFGINIVFIPSALAAILGAVPFLGTYWAAVPAVLWLTQGLGCKAILLLIFHLLPTYFVDTAIYSDISG---GGHPYLTGLAVAGGAYYLGLEGAIIGPILLCILVVASNIYSAMLVSPTNSVPTPNQTPWPAQPQRTFRDISER 273
2 -17.700sp|Q9H330|CI005_HUMAN Transmembrane protein C9orf5 OS=Homo sapiens GN=C9orf5 PE=1 SV=2 (Range: 751-911)  ali follow..  13  1.........................................................................................................................................................................................................................................................................................................................PFLGTYWAAVPAVLLWLTQGLGCKAILLLIFLLPTYFVDTAIYSDISG---GGHPYLTGLAVAGGAYYLGLEGAIIGPILLCILVVASNIYSAMLVSPTNSVPTPNQTPWPAQPQRTFRDISER 123
3 -8.350sp|Q9H330|CI005_HUMAN Transmembrane protein C9orf5 OS=Homo sapiens GN=C9orf5 PE=1 SV=2 (Range: 451-750)  ali follow..  168....................................................................................................................................................................................SILESLWIVMSRNVSLLFTTVTTLLTILFYSGTALLNFVLSLIIFLTTLFYLLSSSDEYYKPVKWVISLTPLSQPGPSSNIIGQSVEEAIRGVFDASLKMAGFYGLYTWLTHTMFGINIVFIPSALAAILGAV............................................................................................................................ 300
4 -8.260sp|Q9UPI3|FLVC2_HUMAN Feline leukemia virus subgroup C receptor-related protein 2 OS=Homo sapiens GN=FLVCR2 PE=1 SV=1  ali follow..  47VHPSSSAHPSALAQPSGLAHPSSSGPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVIDWLSMCYMLTYIPLLLP-LLEKFGLRTIALTGSALNCLGAWVKLGSLKPHLFPVTVVGQLICSVAQVFILGMPSRIASVFGA-----------------------EVSTACSVAVFGNQLGIAIGFLVPPVLVPNIEDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPPSRAQSLSYALTSPDASYLGSIARLFKNLNFVLLVITYGLNAGAFYA---LSTLLNRMVGRIGLTIVIAGMLGAVISYTFTLNLGHLWVVFITAGTMLGFEFAVELTYPESEGISSGLAQVFGIIFTISQGQIIDNYGGNIFLCVFLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTS.... 515
5 -8.050sp|Q5SR56|HIAL1_HUMAN Hippocampus abundant transcript-like protein 1 OS=Homo sapiens GN=HIATL1 PE=1 SV=3  ali follow..  3VEPPPELEEKAASEPEAGAMPEKRAGAQAAGSTWLQGFGRPSVYHAAIVIFLEFFAWGLTPMLTVLHETFSQHTFLMNGLIQGFLSAPLIGALSDVW-----------------RKPFLLGTVFFTCFPIPLMRISPWWYFAMISVSGVFSVTFSVIFAYVADVTQEHERSTAY----------GWVSATFAASLVSSPAIGAYLSASYGDSLVVLVATVVALLDICFILVAVPESLPEKMRPVSWGAQISWKQADPFASLKKVGKDSTVLLICITVFLSYLPEAGQYSSFFLYLRQVIGF-IAAFIAMVGILSIVGLGFQMLQLAWYGFGSQAWMMWAAGTVAAMISALVSRNAESDQQGVAQGIITGIRGLCNGLGPALYGFI.................................................... 400
6 -7.760sp|Q96FL8|S47A1_HUMAN Multidrug and toxin extrusion protein 1 OS=Homo sapiens GN=SLC47A1 PE=1 SV=1  ali follow..  1MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQLMVFLILGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLIS--------QTYGSQNLKHVGVILQRSALVLLLCCFPCWALFLNTQHIL-LLFRQDPDVSRLTQTYVTIFIPALTFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGA--QSIVYELAIIVYMVPAGFSVAASVRVGNAL---GDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFDRDIINLVAQVVPIYAVSHLFVGLPILGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHANLKVNNVPRSG.... 484
7 -7.490sp|Q6NT16|CF192_HUMAN MFS-type transporter C6orf192 OS=Homo sapiens GN=C6orf192 PE=2 SV=1  ali follow..  10  1MEALGDLEGPRAPGGDDPAGSAGETPGWLSREQV--------FVLISAASVNLGSMMCYSILGPFFPKEAE-ASNTIIGMIFGLLASLVFGNYLVHI-----------------AKFMFVAGMFVSGGVTILFGVLDRVPDGPVFIAMCF--LVRVMDAVFAAAMTASSSILAKAFPNNVATVLGSLETFSGLGLILGPPVGGFLYQSFGYEVPFIVLGCVVLLMVPLNMYILPNYESDPGEHSGFLDPTLSLFVLEKFNLPAGYVGLVFLGMALSYAISSPLFGLLS-KWLLVFGNLITAGCYMLLGPVPILHIKSQLWLLVLILVVSGLSAGMSIIPTFPEILSCAHENGFEEGLSTLGLVSGLFSAMWSIGAFMGPTLGGFLGFEWAAAIQGLWALISGLAMGLFYLLEYSRRKRSKSQNILSTEEERTTLLPN 454
8 -7.450sp|Q8NBP5|MFSD9_HUMAN Major facilitator superfamily domain-containing protein 9 OS=Homo sapiens GN=MFSD9 PE=2 SV=2  ali follow..  10  4..GGHWDMNSAPRLVSETAERKQEQKTGTEAEAADSGAVGARRFLLCLYLVGFLDLFGVSMVVPLLSLHVKSLSPTVAGIVGSLFSSTLVGCWSDVV-----------------RRSSLLACILLSALGYLLLGAATNVFLFVRVPAGIFKHTLSISRALLSDVVPEKERPLVI----------GHFNTASGVGFILGPVVGGYLTELEDGFYLTAFICFLVFILNAGLVWFFPWREAKPGSTEKGLPLRKTHVLLGRSHDTVQEAATSMKNLLFSEMWDIFLVRLLMAMAVMLYYSNFVLALGYLISYSSMLGAVAGLASSILTCTLLLLYSLAPTMGAVVLSSTLLSFSTAIGRTCITGTLIGVGQSVTAVGRIIAPLLSGVA-PSLGAVLALVAIFIMSLNKRHSSGDGNSKLKSE.................. 474
9 -7.320sp|Q6YI46|TMM64_HUMAN Transmembrane protein 64 OS=Homo sapiens GN=TMEM64 PE=2 SV=2  ali follow..  120..........................................................................................................................................................................................................................CRSLVLVCVLAALCFASLALVRRYLHHLLLWVESLDSLLGVLLF---------------VVGFIVVSFPCGWGYIVLNVAAGYLYGFVLGM--GLMMVGVLIGTFIAHVVC----EGGSGLKVVALARLTPIPFGLQNNYLMASSVGLLP--QLLNSYLGTTLRTMLQIIISIGLMFYVVHRAQVELNAAIVACEMELKSSLVKGNQPNTSGSSFYNKR 368
10 -7.320sp|Q96MC6|HIAT1_HUMAN Hippocampus abundant transcript 1 protein OS=Homo sapiens GN=HIAT1 PE=2 SV=2  ali follow..  11  2.....TQGKKKKRAANRSIMLAKKIIIKDGGTPQGIGSPSVYHAVIVIFLEFFAWGLLTAPTLVVLHETFPKHTFLMNGLLLSFLSAPLIGALSDVW-----------------RKSFLLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTFSVVFAYVADITQEHERSMAY----------GLVSATFAASLVTSPAIGAYLGRVYGDSLVVVLATAIALLDICFILVAVPESLPEKMRPASWGAPISWEQADPFASLKKVGQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKF-VAAFIAVLGILSIIGLGFQILQLAWYGFGSEPWMMWAAGAVAAMVSALVSRTADADQQGVVQGMITGIRGLCNGLGPALYGFI.................................................... 392

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.