current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15644644|ref|NP_206813.1| co-chaperonin GroES (HP0011) [Helicobacter pylori 26695], from H.pylori

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MKFQPLGERVLVERLEEENKTSSGIIIPDNAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIVGSGSCCHTGNHDHKHAKEHEACCHDHKKHLast
1 -48.200sp|P61604|CH10_HUMAN 10 kDa heat shock protein, mitochondrial OS=Homo sapiens GN=HSPE1 PE=1 SV=2  ali follow..  37  8.KFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD........................... 102
2 -7.320sp|Q13009|TIAM1_HUMAN T-lymphoma invasion and metastasis-inducing protein 1 OS=Homo sapiens GN=TIAM1 PE=1 SV=2 (Range: 751-1050)  ali follow..  13  86IEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEIL---------EINNRAADALNSSMLKDFLSQPS......................... 169
3 -7.160sp|Q9H0E9|BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens GN=BRD8 PE=1 SV=2 (Range: 151-450)  ali follow..  16  252...................................................................IAVSYTGEELDFETVGDIIAIIEDKVDDHPEVLDVAAVEAALSFCEEND.. 300
4 -7.110sp|Q5JS54|PSMG4_HUMAN Proteasome assembly chaperone 4 OS=Homo sapiens GN=PSMG4 PE=2 SV=2  ali follow..  28FHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPE........................ 121
5 -6.380sp|Q9C0C9|UBE2O_HUMAN Ubiquitin-conjugating enzyme E2 O OS=Homo sapiens GN=UBE2O PE=1 SV=3 (Range: 151-450)  ali follow..  15  2..........VVRHMRSTDSQCGTVIIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGA........................ 88
6 -6.200sp|Q9P202|WHRN_HUMAN Whirlin OS=Homo sapiens GN=WHRN PE=1 SV=3 (Range: 1-300)  ali follow..  12  140..........LVSLRRAKAHEGLGFSIRGGSEHGVGI-YVSLVEPGSLAEKEGLRVGDQIL---------RVNDKSLARVTHAEAVKALKGSKK........................ 213
7 -6.180sp|Q8TEU7|RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens GN=RAPGEF6 PE=1 SV=2 (Range: 301-600)  ali follow..  12  231...........VVLQKASRESPLQFSLNGGSEKGFGI--VEGVEPGSKAADSGLKRGDQIM---------EVNGQNFENITFMKAVEILRN........................... 300
8 -6.140sp|Q96GX9|MTNB_HUMAN Probable methylthioribulose-1-phosphate dehydratase OS=Homo sapiens GN=APIP PE=1 SV=1  ali follow..  16  14............RRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGG-----ISLKHGDEIYIAPSGVQKERIQPEDMFVCDINE--KDISGPSPSKKLKKSQCTMRGAGAVIHTHSKA 120
9 -6.110sp|Q9C0C9|UBE2O_HUMAN Ubiquitin-conjugating enzyme E2 O OS=Homo sapiens GN=UBE2O PE=1 SV=3 (Range: 1-300)  ali follow..  18  142.....LEDRSVVVRHMRSTDSQCGTVIDVNIDCAGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTE........................... 235
10 -6.050sp|Q9UBK2|PRGC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator 1-alpha OS=Homo sapiens GN=PPARGC1A PE=1 SV=1 (Range: 151-450)  ali follow..  15  123...SPFENKTIERTLSVELSGTAGLTPPTTPPHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSKSSVLTGGHEERKTKRPSLRLFGDHD.. 235

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.