current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|P08908|5HT1A_HUMAN 5-hydroxytryptamine receptor 1A OS=Homo sapiens GN=HTR1A PE=1 SV=3, from H.sapiens

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFCRQLast
1 -93.800[R] KOG3656 FOG: 7 transmembrane receptor  ali follow..  33  47.HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVND--DKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGI--------------------------------------------------------------VKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNI 406
2 -87.700[T] KOG4220 Muscarinic acetylcholine receptor  ali follow..  24  2.......EGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKC--VPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKK 517
3 -71.300[T] KOG4219 G protein-coupled receptor  ali follow..  21  1MDNVLPVDSDLSPNISTNTSEPNQFV----QPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQ--PRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEI--------------------------------------------------------------------------------------------------PGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLKKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDRFRLGFKHAFRCCPFIS 327
4 -44.200[T] KOG2087 Glycoprotein hormone receptor  ali follow..  20  364.....................................ILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKDWQTG-AGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCKVQLRHAASVMVMGWIFAFAAALFPIFGISSYM---KVSICLPMDIDSPLVMSLLVLNVLAFVVICGCYIHIYLTVRN-----------------------------------------------------------------------------------------------------------PNIVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKAKILLVLFH--INSCANPFLYAIFTKNFRRDFFILLSKCGCYE 648
5 -12.900[T] KOG4564 Adenylate cyclase-coupled calcitonin receptor  ali follow..  12  142......................................VKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMHLFISFILRAAAVFIKDLALFDSGE---GSVGCKAAMVFFQYCVMANFFWLLVEGLYLYTLLAVSF----FSERKYFWGYILIGWGVPSTFTMV----WTIARIHFEDYGCWDTINSSLWWI-----IKGPILTSILVFICIIRILLQKLR-----------------------------------------------------------------------------------------------------PPDIRKSDSSPYSRLARSTLLLI--------PLFGVHYIMFAFFPDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQG 410
6 -10.500[I] KOG3845 MLN, STAR and related lipid-binding proteins  ali follow..  1..................................................MSGRQPLISPGSQRIGVSKDRKRFIV-ITFFDTSITILL------------WLL-KVFFNEINIFNPKFIRISLFDIVLLAVLRMLILG--VVYGICLVKQWYTVAFTTLASSAYILMKVLFYFNH-------------SSSAVPPLLLIITSFTLCWSEFYLMPFQILPRERRYARRELDGIENPEFSTDDEARSNNRHRRGRRQQNSGNQSEAPTAVPSRVSSGVFIASDYDEFRSAAE................................................................................................................................... 222
7 -9.360[T] KOG4193 G protein-coupled receptors  ali follow..  11  359LLTTNKTHTTCSCNHLTNFAVLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNTIHKNLCIS-LFVAELLFLIGINRT-------QPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFE----SEHSRRKYFYLVGYGMPALIVA--VSAAVDYRSYGTDKVCWLRLDTYF-----IWSFIGPATLIIMLNVIFLGIALYKMFHHT----------------------------------------------------------------------------------------AILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWA--------------------YINESTVIMAYLFTIFN-IFHCVLQKKVRKEYGKCLRTHCCSG 665
8 -9.150[S] KOG4610 Uncharacterized conserved protein  ali follow..  1........................................MAKIISTIKAILTRIIFLLAIWQVVALKSDIIYWALCGPLLLLLLGIFTI-LYLSSIVPAIWLLELDKVALSVTPDTWTTLIEQFLMLILIVGRWLLFFDSYKDDSIAKIGFLVFLTLGIWSWSLMQFTIVLSATRGSHHKEEHTDCCQNCCCGIDVWGIVLNVILPFLTFIINYMNVFFTCKNSLVIILQLYRLYVVNAEFWKNRRESRMAKSRQFQSRRKVQDADQNSIYMISNERGGDVKKKIKRAKDKDYAEQEAVYSKKKKDKKDKKKRKRKDTGYSTASSQNLYSTKASGTDKDTRRKD............................................................................. 421
9 -7.770[R] KOG1314 DHHC-type Zn-finger protein  ali follow..  11  21...................................HWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIMLINWTVMILYNYFNAMFVGPGFVPLGWK---KVCQAYKAPRSHHC--RKCNRCVMKMDHHCPINNCCGYQNHASFTLFLLLAPLGCIHAAFIFVMTMYTQLYHRLSFGWNTVKIDAAFATTLFALGLALGTTIAVGMLFFIQMKIILRNKTSIESWIEEKAKDRIQYYQLDEVFVFPYDMGSRWRNFKQVFTWSGVPEGDGLEWPVREGCHQYSLTIEQLKQKADKRVRSVRYKVIEDYSGACCPLNKGIKTFFTSPCTEEPRIQLQKGEFILALYGDKIL-WFP.............................................................. 389
10 -7.740[I] KOG1617 CDP-alcohol phosphatidyltransferase/Phosphatidylglycerol-phosphate synthase  ali follow..  16  110............................................VLTLGRVAAVPLLVATFYVDSWWGTTATTSIFIAAITDWLDGYLARKMRLGSA------FGAFLDPV---ADKLMVAATLILLCIAIIGREITMSAVREWAASQNGKKWKTATQMTALTILLAS.............................................................................................................................................................................................................................................................. 256

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.