current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q99490|AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=AGAP2 PE=1 SV=2 (Range: 1-300), from H.sapiens

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAVGAPGARGSEPRDPGSPRGAEEPGKKRHERLFHRQDALWISTSSAGAGGAEPPALSPAPASPARPVSPAPGRRLSLWAAPPGPPLSGGLSPDSKPGGAPSSSRRPLLSSPSWGGPEPEGRTGGGVPGSSSPHPGTGSRRLKVAPPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASVSAAATAAAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPPTPSLast
1 -28.100[R] KOG2350 Zn-finger protein joined to JAZF1 (predicted suppressor)  ali follow..  670.WLDVGMHKKQEDPKTLKSPQKPAPPADQASTSSASTSGSGSGSSSMQPPKRMPAHLKRGSAASSPGVQSKGTENGTNGSNSSSSNSKNVAKKSADQPLSTLANTRERRSEYGQKRNVSGSRLAATPASKRKLSSKDVEQAADAPEVLTHSDNAVDVGIIDDECGGFGAVGVMNGVASPVANNSEMDTEAEVEAEPTATKAITIHCQQPVTTPVAAAATANERLPGVAPHRRGPRRADRREEELVASAPGYRCRPSMRGADAGAAAAAAAAPTHPHPHRPPPPPPP.............. 954
2 -17.400[Z] KOG3756 Pinin (desmosome-associated protein)  ali follow..  419.NEASKELEPEMEFEIEPDKECKTLSPGKENVSALDMEKESEEKEEKESEPQPEPVAQPQPQSQPQLQLQSQSQPVLQSQPPSQPEDLSLAVLQPTPQVTQEQGHLLPERKDFPVESVKLTEVPVEPVLTVHPESKSKTKTRSRSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGSSSRDSSSSTSSSSESRSRSRGRGHNRDRKHRRSVDRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKRSSRSERDRKSDRKDK.. 715
3 -13.200[TZ] KOG4035 Coeffector of mDia Rho GTPase, regulates actin polymerization and cell adhesion turnover  ali follow..  10  123.HSYSDKGSHRHSHPHPTQSQTQLHSQHRQHSPPPSGGSVGSQRLDMSKKSMSSPAVGSSCGLPQNQGMIESPSMGSMQFQGSSCTIQTPQQQQPLPAPPAPAPSPSAASATPTAASTSKAATGGDVAQDNSITSEPSETTTTTTTTSEDVVTTYKETSQMSTSQQHKPQNGSTASASISASASASALRSNGGNGKANGSATALHQELQQEEADSAPDKSDDASAVQSDDGCPANGDSADNSQALDSIDSPSHRQRGLSLGRIEEGATGGGQLKVESSDVYQ.................. 403
4 -12.600[R] KOG0562 Predicted hydrolase (HIT family)  ali follow..  445......QMISETKLDEAEAKPKLLNEEEPIQAQPVAAIAQYPNEHLGKPLTPQQQPGKQQAQNVYDKNINGPSVNMMNQNNPNNPFRNTPHLNRQSQKPPHPRSGPRGPMAPWTGPRFPCHQQQNRFRPPGFNACRQPYPPYHSGHQQFPNASSVGGGQTGLPGQGQGPRPKWNSNKIFNQQNRQNTVQAQPQAQNQQTNQQQIQNSNKNQTPKKKPWKNRLQPVGKVQNQGGANRDPAPPSNSKPS..................................................... 685
5 -12.000[R] KOG3253 Predicted alpha/beta hydrolase  ali follow..  12  494.VPISSEPPEEGEKEDLRVQLKRHHPSSPLPGSKTSKRPKIKVSLISQGDTAGGPCAPSQGSAPEAAGGKPITMTLGQASAGAKELTGLLTTAKSSSSEGGVSASPVPSVVSSSTAPSALHTLQSRLVATSPGSSLPGATSASSLLQGLSFSLQDISSKTSGLPANPSPGPAPQATSVKLPTPMQSLGAITTGTSTIVRTIPVATTLSSLGATPGGKPTAIHQLLTNGGLAKLASSLPGLAQISNQASGLKVPTTITLTLRGQPSRITTLSPMGSGAAPSEESSSQVLPSSSQRLPPAP. 791
6 -11.800[TU] KOG3895 Synaptic vesicle protein Synapsin  ali follow..  625.SVSDSRNTDTLTERAGAGYQPVTNYEQQERVNPFDKEPSKSGSAASIHTSSSSSISSSSISSRINRNGNAIQSPPPPAGPPPPPPTNVTAVGSNANSSSGYRNSFSSSLSKDKTSYGNYGSTTSVETITRMDTNTTNIGATATEAGEASGVTAITNISNSDGIVAPTTGTITTSVTTNDWRSAIGMRSASVYSAPAAVTTVLPGDTSGYDSNSIASQGEGLNNPSDLPSYTRPSYSRSESNASKHSDLDVIFGDSKTTPASYGNGKYTRAAGSISDADMIFGGPPSNYKTDRFGASKSM 923
7 -11.800[K] KOG3915 Transcription regulator dachshund, contains SKI/SNO domain  ali follow..  14  1MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPIASAAAAAATVTSTGGGGGGGGSGGGGGSSGNGGGGGGGGGGSNCNPNLAAASNGSGGGGGGISAGGGVASSTPINASTGSSSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVENTPQNNE................................................................................................................. 187
8 -11.600[P] KOG3684 Ca2+-activated K+ channel proteins (intermediate/small conductance classes)  ali follow..  1MDTSSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQPQPPQLQQQQQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAILHPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMKPLSRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTAASSTTFP................................................. 256
9 -10.700[K] COG5164 Transcription elongation factor  ali follow..  10  850..........................................................................................REGGEGITYDELVNRRGRVPQARMGPSYVSAPRNMATGGIAAGAAATSSGLSGGMTPGWSSFDGGKTPAVNAHGGSGGGGVSSWGGASTWGGQGNGGASAWGGAGGGASAWGGQGTGATSTWGGASAWGNKSSWGGASTWASGGESNGAMSTWGGTGDRSAYGGASTWGGNNNNKSTRDGGASAWGNQDDGNRSAWNNQGNKSNYGGNST 1059
10 -10.600[R] KOG4377 Zn-finger protein  ali follow..  11  2...........................PKAQHSPQAIFTS----ERSEYSGPGARLPGGSSSTVATAEDRLSLADHDGSATDLTPSRYRKRGRVWAPTSSLEQPSKRIVNQPTHFGARSETESRSSRHESLAQPTLQPSEPLETNSSTNLSSTILDKVSVVRAAGTFYPENANSAAQGET-PEVVSSRYNSRQESNDLEVDQPEDLSMRPSLPEATATPAVVGPALNMNLLQFKQLIDLYQRQVLLPSFLAAASQPLALPGSAAGPGVSGPLLDMRILLENAAQQKLMLLNAAASATASA 272
11 -10.600[S] KOG4511 Uncharacterized conserved protein  ali follow..  11  263.MAATFAIDTATSTDDVTYKFLDQSTGTMTSSTGVSVGTLTNTGVSSGTMTSGVDTGTDADGTVGRPKSAKRVGSAVGKRSVSKGTPSEDAKKSSGSSSPDEAEKSKRERPGTSVKKAIGIVAANSEMSSNGTQMDVPVDEEGTKKRPGTTSKKSIATVTASPEMSSKTTQMEPEQDGEGKKRPETSKGANERKYSNAGLEDIVGPKSSPHEEKKSSHPSSRKGSKATDENAPATRPPSRKAAGGSHEPRAKTPNQKNKDERPTTRRSSVDKNAPKRNDSVPRERKSSVSHDESKPPKPI 561
12 -10.500[B] KOG2266 Chromatin-associated protein Dek and related proteins, contains SAP DNA binding domain  ali follow..  472.................................................................................................KSSKGAKRKRTPKKTSPTAGSSSSKRSAKSQKKSEEATKVVKKSLAHSDDESEEEKEEEEKQEEEKAEEKEEKKEEENENGIPDKSEDEAPQPSESEEKDESEEHSEEETTKKKRGSRLSAGKKESAGRARNKKAVVAAKSSPPEKITQKRSSAKRKKTDDDSDTSPKASSKRKKSENPIKASPAPSKSASKEKPVKGKDKPS 678
13 -10.400[U] COG3846 Type IV secretory pathway, TrbL components  ali follow..  279VGGGGATAGIGNFGAGAAIAAAATGAAVAATAGSALAAGLSSAGGGVSALKAAFQSAQQNMASGGGSGSGSGSGGNSAGVSSGGSSSFMSAMGTTGRFAADMGTSLAKGVGQVAKDKAGSVIASAKERVADTTGGKVASAIRNSMDAASGQNDFKGDSLAGAAQRGSETAMNDEVAAFVNKGKQH................................................................................................................... 463
14 -10.400[TZ] KOG3671 Actin regulatory protein (Wiskott-Aldrich syndrome protein)  ali follow..  12  330LDPSQISSPLPPPIQQHPQMNQSWNQTPVRQYKPSFPSSAPIGSGASSYSTPAAPPPPTRVESHGLAPARPPPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPPPPPQSFGMAPISSAAPPPPPPPPPMGLPAVGAGAPPPPPPPPPSGAGGPASVLAKLPPAQDGRSNLLAEIQAGKQLRSVQQTADSPKSAGGDA................................................................................................ 533
15 -10.200[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  442LNAIYEQREQTLARQTSLPSLSSDSSLSMSIGRGHWGGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPPKPKVQIPGLNRPQIADPKQWGKKSSTQDTNVHDNLRELNTTSGGNKKKGK................................................................................................................ 629
16 -9.270[O] KOG0802 E3 ubiquitin ligase  ali follow..  10  389LDQGLNEVYSPTCRKPLFVGRTENEVNPRTVEVSSDEQLARQLERQNNPVHALATGLFPAEVPDSVENDTSRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGLGRVQMMMRHLASVGESYAQTALDDAAWSLWPMNPSQASTSSTTVPPGNGGRTGGLHLRTVSNTTNESLTNILAMAETVREVMPHVPDEIIFQVNFKCILD................................................................................................. 592
17 -9.000[DK] KOG4333 Nuclear DEAF-1 related transcriptional regulator (suppressin) and related SAND domain proteins  ali follow..  366VVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSSAKSSSPDTVTIH----PSSSLALLSSTAMQDGSTLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQHQ................................................................................................... 562

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.