current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q9H013|ADA19_HUMAN(removed signalp:1-25) Disintegrin and metalloproteinase domain-containing protein 19 OS=Homo sapiens GN=ADAM19 PE=1 SV=3 (Range: 751-930), from H.sapiens

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst VINTPEILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPIPPAPNCIVSQDFSRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAALAPKVSPREALKVKAGTRGLQGGRCRVEKTKQFMLLVVWTELPEQKPRAKHSCFLVPALast
1 -20.200[R] KOG2350 Zn-finger protein joined to JAZF1 (predicted suppressor)  ali follow..  778.SEYGQKRNVSGSRLAATPASKRKLSSKDVEQAADAPEVLTHSDNAVDVGIIDDECGGFGAVGVMNGVASPVANNSEMDTEAEVEAEPTATKAITIHCQQPVTTPVAAAATANERLPGVAPHRRGPRRADRREEELVASAPGYRCRPSMRGADAGAAAAAAAAPTHPHPHRPPPP-PPP. 954
2 -16.400[Z] KOG3756 Pinin (desmosome-associated protein)  ali follow..  416..PSENEASKELEPEMEFEIEPDKECKTLSPGKENVSALDMEKESEEKEEKESEPQPEPVAQPQPQSQPQLQLQSQSQPVLQSQPPSQPEDLSLAVLQPTPQVTQEQGHLLPERKDFPVESVKLTEVPVEPVLTVHPESKSKTKTRSRSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSG 593
3 -16.200[TZ] KOG3671 Actin regulatory protein (Wiskott-Aldrich syndrome protein)  ali follow..  12  331..DPSQISSPLPPPIQQHPQMNQSWNQTPVRQYKPSFPSSAPIGSGASSYSTPAAPPPPTRVESHGLAPARPPPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPPPPPQSFGMAPISSAAPPPPPPPPPMGLPAVGAGAPPPPPPPPPSGAGGPASVLAKLPPAQDG...... 502
4 -15.700[P] KOG3684 Ca2+-activated K+ channel proteins (intermediate/small conductance classes)  ali follow..  1MDTSHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQPQPPQLQQQQQQQQQQQQQ-QPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAILHPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSG 182
5 -14.300[S] KOG2490 Predicted membrane protein  ali follow..  2................GSNTSPGQADPLESENESSLTSRFLPNKRDGGKDNESVIPEKEEPDLNEPVLAVPLPKSRYALTKRSSSSEYPRRSASTSAKKNVIPITRSYSTTFFSKTNDQPTVTGNQDKPISRLRASKLQIQNFWNYICFELLANDTVPANPIKEKH.............. 151
6 -13.600[R] KOG1777 Putative Zn-finger protein  ali follow..  11  2..................SSSSSP-PPPQQVMDDTTQQSPSYSQNSNSPSQHTFESMEPAAGGSTSMRYSPSGSSEADNPTGLFSAQASYPYSLRKRRPCLTKDEDLCFPITAATADETPQPTMKKFKLECLSPGEARDFSIEDESGTNLEAKMETTECEPEEEEAVEEEDQQ--NRLP. 166
7 -12.900[TV] KOG3966 p53-mediated apoptosis protein EI24/PIG8  ali follow..  10  365.QQYELQQRQRLLQRDEQLLKQRKQQYVQQQRLQQEQLMRRDRSHSRSQTPQLGHPHRYAQAPVFDAGRVRDSSASSTHSSNAPSINSHRPPPYYGSSLRGAAPLVPTPVPGAPRAPLTPPVIRQESGPDD................................................. 494
8 -12.200[R] KOG0562 Predicted hydrolase (HIT family)  ali follow..  10  472..PVAAIAQYPNEHLGKPLTPQQQPGKQQAQNVYDKNINGPSVNMMNQNNPNNPFRNTPHLNRQSQKPPHPRSGPRGPMAPWTGPRFPCHQQQNRFRPPGFNACRQPYPPFPNASSVGGGQTGLPGQGQGPRPKWNSNKIFNQQNRQNTVQAQPQAQNQQTNQQQIQNSNKNQTPKKKP. 655
9 -11.800[TZ] KOG4035 Coeffector of mDia Rho GTPase, regulates actin polymerization and cell adhesion turnover  ali follow..  209.QTPQQQQPLPAPPAPAPSPSAASATPTAASTSKAATGGDVAQDNSITSEPSETTTTTTTTSEDVVTTYKETSQMSTSQQHKPQNGSTASASISASASASALRSNGGNGKANGSATALHQELQQEEADSAPDKSDDASAVQSDDGCPANGDSADNSQALDSIDSPSHRQRGLSLGRIEEG 387
10 -11.400[S] KOG1103 Predicted coiled-coil protein  ali follow..  312...RRNLTLTGAKMSIDKPGNVLPQLPPDTGSLIMANRGAKPAVNRQQPAPPPVARLPNSATFPTEKSRLPRAPPPAVTTPVPRMSIGSLPASSSNVPRTMSSPVKKTPVMGVSSTAVRRPQSAATTTMPTTSVITNTSAVMPLSPDLEQLEAAIQSMNAGPSSNVASERKLSGTVKRNG 488
11 -11.300[S] COG5373 Predicted membrane protein  ali follow..  31IESLKAEIARLAKEGMGEPGPDLATGRPSEAGVPSVAGTEATADGPWSRAREGAGTSHDESAAGRESGDGAIDGPVAPSAAAARAES............................................................................................. 117
12 -11.200[S] KOG2357 Uncharacterized conserved protein  ali follow..  20...............HHVLASSSSDFEGFDAEDDDVSEDSTELHHSLRPPLLTQSESTVLDLDPSPDSDSTPASKSDPPTQTVKPSSSISFDYWDEDEFEGLPEDEKSTESPVFSDDASSPADPQTPDLESASE.............................................. 138
13 -11.100[YU] KOG1964 Nuclear pore complex, rNup107 component (sc Nup84)  ali follow..  2.....DRSGFGEISSPVIREAEVTRTARKQSAQKRVLLQASQDENFGNTTPRNQVIPRTPSSFRQPFTPTSRSLLRQPDISCILGTGGKSPRLTQSSGFFGNLSMVTNLDDSNWAAAFSSQRSGLFTNTEPHSITEDVTISAVMLREDDPGEAAS......................... 151
14 -11.100[S] KOG4610 Uncharacterized conserved protein  ali follow..  346..SIYMISNERGGDVKKKIKRAKDKDYAEQEAVYSKKKKDKKDKKKRKRKDTGYSTASSQNLYSTKASGTDKDTRRKDKKGKKSKRTCSSSPSDCDLAKKQKRKNADKNDKKKSRKIEAVVEESSSSSSSSSDSSNSTLPSYEVIDEKKARRRKHRGSSSDTSSGDSSSSSSSSSSSDSS 523
15 -11.000[S] KOG4556 Predicted membrane protein  ali follow..  10  287VTSLVSFDPKSATLLRIRQHLEAEPSDRDTPDYDMYERLRSRSSGHSEVAPASTIPLSSDYKSRNASQDSVPSMFAPMLNSPAPSSTTSGSSSRTSGASLAHKTHIVGKGGISLSTVDPSPILSPGIRLSEQLGAKNQSYKSAFRVQKTENARVISHYHAPNEIPSSDPSVVENESNYPV 467
16 -11.000[G] KOG2175 Protein predicted to be involved in carbohydrate metabolism  ali follow..  12  680...EQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVGLVDYPDDEEEDEEEESSPRKRPRLGS....... 849
17 -10.800[O] KOG2062 26S proteasome regulatory complex, subunit RPN2/PSMD1  ali follow..  787SNVRPKLFAYPPKSVQPTAKTVQKVETAVLSTTVKAQARAKRAEREKASKGSNDDEMKIDKKTTEEKEATPMEMDEEKSQDISINGNSKKEEPKSETLENFTRVVPAQLP-NLNGRYYPVRKFTGGVLMLIDRESDKAPDLIELNRDAVPASADTEPGEQEASPPED............. 956
18 -10.800[O] COG5116 26S proteasome regulatory complex component  ali follow..  787SNVRPKLFAYPPKSVQPTAKTVQKVETAVLSTTVKAQARAKRAEREKASKGSNDDEMKIDKKTTEEKEATPMEMDEEKSQDISINGNSKKEEPKSETLENFTRVVPAQLP-NLNGRYYPVRKFTGGVLMLIDRESDKAPDLIELNRDAVPASADTEPGEQEASPPED............. 956
19 -10.800[W] KOG3658 Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases  ali follow..  11  771.TPSTNPNKPPALNIYQTLTRPGTLIRQHRQRHRAAAGSVPPGPGAQPRSGAASAPSRTTPSARPSAPPLVAPQVAVAVPPGVVGPPIPLIATHPGSSSSTPAVIVLEPPPPYTAADPGSAMGGPRRGHRKNKRQTSSDAAGSSGNGGKKKGK........................... 922
20 -10.600[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  10  457.TSLPSLSSDSSLSMSIGRGHWGGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPPKPKVQIPGLNRPQIADPKQWGKKSSTQDTNVHDNLRELNTTSGGNKKKGKQK.... 631
21 -10.600[S] KOG4592 Uncharacterized conserved protein  ali follow..  11  74..ATARSYVAATAEGISGPRTDGTAAAGPLDLKPMESLWSTAPPPAMAPSPQSTMAPAPAPQQMAPLQPILSMQDLERQQRQMQQQFMNFHAMGHPQGLPQGPPQQQFPMQPASGQPGPSQFAPPPPPPGVNVNMNQMPMGPVQVPVQASPSPIGMSNTPSPGPVVGATKMPLQSGRRS. 250
22 -10.600[A] KOG2242 Scaffold/matrix specific factor hnRNP-U/SAF-A, contains SPRY domain  ali follow..  30AERLQAALEAEEPDDERELDADDEPGRPGHINEEVETEGGSELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDD.... 205
23 -10.500[K] KOG3915 Transcription regulator dachshund, contains SKI/SNO domain  ali follow..  10  2...AVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPIASAAAAAATVTSTGGGGGGGSGGGGGSSGNGGGGGGGGGGSNCNPNLAAASNGSGGGGGGISAGGGVASSTPINASTGSSSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPV 179
24 -10.300[A] KOG4746 Small nuclear RNA activating complex (SNAPc), subunit SNAP43  ali follow..  287..SVKPVIVPAETFEYAPDPKKKKEAQETMPVSGRNGRKRGRPKSVPKSKVSNPARILYEKLAEDMISEHLSTDLTEQEAFTDRPQSSLEPQKNELFNWDAAPQDAQISNQTTEPSCGEDIFIEDFGEFKSQDDVMFTAEDFNDSLIPPLADSDSDLEIDA................... 445
25 -10.300[S] KOG4502 Predicted membrane protein  ali follow..  154.EDQQESVDVVEKVEAVPPTTTTTKLTTLPSTTQSTTTRTTTQPSTIVSTRQKYVNVDGDIYVPGKTVISVSSTPIVDRTGTTTPVSIEISTTTLPPMTEIFTTKYSTLSTSYTHTPSPHIFSSSTVRLPIAIPIPTKLPEIMFTTPRPYRGPFITEFTIEPKRSEGRTSLRDRIRSTSQ 332
26 -10.300[B] KOG2266 Chromatin-associated protein Dek and related proteins, contains SAP DNA binding domain  ali follow..  501..SQKKSEEATKVVKKSLAHSDDESEEEKEEEEKQEEEKAEEKEEKKEEENENGIPDKSEDEAPQPSESEEKDESEEHSEEETTKKKRGSRLSAGKKESAGRARNKKAVVAAKSSPPEKITQKRSSAKRKKTDDDSDTSPKASSKRKKSENPIKASPAPSKSASKEKPVKRAGKGKDKPS 678
27 -10.200[W] KOG4291 Mucin/alpha-tectorin  ali follow..  10  627.SSEGSQNRNSSKLARDISYINPNVTTGEKPKQLGRRSLHSASGTELDQHGSPVDGDHPDEDDDFDEADVHTGTTHPVGYHQPLSPEEADQLHRQQYSPT--SGLDSRTSGASSINYTPQAATQNRFGGVPVLPSNTQ---SRPPSSVNTVPLRTAPTPLTQDTGLPSP----PLATSPT 799
28 -10.100[R] KOG4334 Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain  ali follow..  688ISLVYPPRKFLYGLATNSTGIKHDIRNVLTQTLMATLPPPPPQFFPMIGGPPLMHPTFSTSAPPPPPPPQPMEYGYNPMKQMPSRKRGRHDDSSSPSHQKPHK............................................................................. 790
29 -9.970[R] KOG0231 Junctional membrane complex protein Junctophilin and related MORN repeat proteins  ali follow..  10  532.....GEEQAGGSRGVRSGALRGGLLVDDFRTRGSGRKQPGNPKPRERRTESPPVFTWTSHHRASNHSPGGSRLLELQEEKLSNYRMEMKPLLRMETHPQKRRYSKGGACRGLGDDHRPEDRGFGVQRLRSKAQNKENFRPASSAEPAVQKLASLRLGGAEPRLLRWDLTFSPPQKSLP. 705
30 -9.940[K] KOG0323 TFIIF-interacting CTD phosphatases, including NLI-interacting factor  ali follow..  10  476AEQKPETPKPQIAVIPNNASTATAAALLPSHKPSLLGAPRRDGFTFSDGGRPLMMRPGVDIRNQNFNQPPILAKIPMQPPSSSMHSPGGWLVDDENRPSFPGRPSGLYPSQFPHGTPGSAPVGPFAHPSHLRSEEVAMDDDLKRQNPSRQTTEGGISQNHLVSNGREHHTDGGKSNGGQS 655
31 -9.720[P] KOG1418 Tandem pore domain K+ channel  ali follow..  12  610....SPWPHAAEMNRPKEATRLGEPSALRVSAPNLTISGGNRSPSGGALSVITEASDEDTRHFKKHRRPLAKTVSTDGTVSNHGSAESLDQVMDELQLESHDQAVTPKPYRDPTTSTRFRKRDETVVSRAEKMPLSPNEVLEEEDEDENGDT............................ 757
32 -9.600[R] KOG4377 Zn-finger protein  ali follow..  10  2....PKAQHSPERSEYSGPGARLPGGSSSTVATAEDRLSLADHDGSATDLTPSRYRKRGRVWAPTSSLEQPSKRIVNQPTHFGARSETESRSSRHESLAQPTLQPSEPLETNSSTNLSSTILDKVSVVRAAGTFYPENANSAAQGETPEVVSSRYNSRQESNDLEVDQPEDLSMRPSLPE 186
33 -9.390[DK] KOG4333 Nuclear DEAF-1 related transcriptional regulator (suppressin) and related SAND domain proteins  ali follow..  12  369..MPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQDGSTLG-NMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETE 545
34 -9.250[U] COG3846 Type IV secretory pathway, TrbL components  ali follow..  297IAAAATGAAVAATAGSALAAGLSSAGGGVSALKAAFQSAQQNMASGGGSGSGSGSGGNSAGVSSGGSSSFMSAMGTTGRFAADMGTSLAKGVGQVAKDKAGSVIASAKERVADTTGGKVASAIRNSMDAASGQNDFKGDSLAGAAQRGSETAMNDEVAAFVNKGKQHE............ 464
35 -9.250[R] KOG4403 Cell surface glycoprotein STIM, contains SAM domain  ali follow..  501..QRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKI 678

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.