current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|P31431|SDC4_HUMAN(removed signalp:1-18) Syndecan-4 OS=Homo sapiens GN=SDC4 PE=1 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYALast
1 -103.000sp|P31431|SDC4_HUMAN(removed signalp:1-18) Syndecan-4 OS=Homo sapiens GN=SDC4 PE=1 SV=2  ali  100  1ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA 180
2 -59.700sp|P34741|SDC2_HUMAN(removed signalp:1-18) Syndecan-2 OS=Homo sapiens GN=SDC2 PE=1 SV=2  ali follow..  34  15............DNSSIEEASGVYPIDDDDYASA--------SGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPE-VHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKAYQKAPTKEFYA 183
3 -40.500sp|P18827|SDC1_HUMAN(removed signalp:1-22) Syndecan-1 OS=Homo sapiens GN=SDC1 PE=1 SV=3  ali follow..  31  151................................................ADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKAYQK-PTKEFYA 288
4 -24.100sp|O75056|SDC3_HUMAN Syndecan-3 OS=Homo sapiens GN=SDC3 PE=1 SV=2  ali follow..  52  362........................................................................................................DNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYTLEEPKTYQK-PDKEFYA 442
5 -19.800sp|Q9ULB1|NRX1A_HUMAN(removed signalp:1-30) Neurexin-1-alpha OS=Homo sapiens GN=NRXN1 PE=1 SV=1 (Range: 1201-1447)  ali follow..  23  159.....................................................................................................................GSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYKKNKDKEYYV 247
6 -19.600sp|Q9HDB5|NRX3B_HUMAN(removed signalp:1-35) Neurexin-3-beta OS=Homo sapiens GN=NRXN3 PE=1 SV=4 (Range: 451-602)  ali follow..  23  65.....................................................................................................................GASEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYQKNKDREYYV 152
7 -18.200sp|P58401|NRX2B_HUMAN(removed signalp:1-50) Neurexin-2-beta OS=Homo sapiens GN=NRXN2 PE=2 SV=1 (Range: 451-616)  ali follow..  23  78.....................................................................................................................GAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYKKNKDKEYYV 166
8 -17.300sp|Q9Y4C0|NRX3A_HUMAN(removed signalp:1-27) Neurexin-3-alpha OS=Homo sapiens GN=NRXN3 PE=2 SV=4 (Range: 1351-1616)  ali follow..  23  179.....................................................................................................................GASEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYQKNKDREYYV 266
9 -15.500sp|Q9P2S2|NRX2A_HUMAN(removed signalp:1-28) Neurexin-2-alpha OS=Homo sapiens GN=NRXN2 PE=2 SV=1 (Range: 1501-1684)  ali follow..  24  97......................................................................................................................AVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYKKNKDKEYYV 184
10 -15.000sp|Q9HDB5|NRX3B_HUMAN(removed signalp:1-35) Neurexin-3-beta OS=Homo sapiens GN=NRXN3 PE=1 SV=4 (Range: 301-600)  ali follow..  22  215.....................................................................................................................GASEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYQKNKDREY.. 300
11 -14.600sp|Q9P2S2|NRX2A_HUMAN(removed signalp:1-28) Neurexin-2-alpha OS=Homo sapiens GN=NRXN2 PE=2 SV=1 (Range: 1351-1650)  ali follow..  10  173............................................FAPSAPAPNLPAGKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPHLPTANPTGPGERGPPGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNY.......... 298
12 -13.700sp|Q5T2D2|TRML2_HUMAN(removed signalp:1-18) Trem-like transcript 2 protein OS=Homo sapiens GN=TREML2 PE=1 SV=2  ali follow..  12  194.........................................................................TASPSNARDSSAGPESISTKSGDLSTRSPTTGLCLTSRSLLNRLPSMPSIRHQDVYS------VLGVVLTLLVLMLIVYGFKKRHMASYSMCSDPSTRDPPGR.... 293
13 -12.400sp|P58401|NRX2B_HUMAN(removed signalp:1-50) Neurexin-2-beta OS=Homo sapiens GN=NRXN2 PE=2 SV=1 (Range: 301-600)  ali follow..  29  240.................................................................................................................................TGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYEKAPAAP... 300
14 -11.800sp|O43155|FLRT2_HUMAN(removed signalp:1-35) Leucine-rich repeat transmembrane protein FLRT2 OS=Homo sapiens GN=FLRT2 PE=1 SV=1 (Range: 451-625)  ali follow..  19  19.........................................................................................VEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGAVI-FVLVVLLSVFCWHMHKKSQKWKYNRGRRK-YCEAGTKK... 110
15 -11.100sp|Q9UHC6|CNTP2_HUMAN(removed signalp:1-27) Contactin-associated protein-like 2 OS=Homo sapiens GN=CNTNAP2 PE=1 SV=1 (Range: 1051-1304)  ali follow..  18  172.................................................................................................................QGQAIRNGVNRNSAIIGGVIAVVIFTILC--TLVFLIRYMFRHK--GTYHTNEAKGAESAESAD... 231
16 -10.900sp|Q9NT99|LRC4B_HUMAN(removed signalp:1-36) Leucine-rich repeat-containing protein 4B OS=Homo sapiens GN=LRRC4B PE=1 SV=3 (Range: 451-677)  ali follow..  18  83.......................................................................................................................DDVMKTTKIIIGCFVA--ITFMAAVMLVAF--YKLRKQHQ------LHKHHGPTRTVEI.. 131
17 -10.800sp|Q13145|BAMBI_HUMAN(removed signalp:1-20) BMP and activin membrane-bound inhibitor homolog OS=Homo sapiens GN=BAMBI PE=1 SV=1  ali follow..  14  97..........................................................................................RGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLI-----LVLLIMLALRMLRSENKRL.................. 163
18 -10.700sp|Q96NU0|CNT3B_HUMAN(removed signalp:1-25) Contactin-associated protein-like 3B OS=Homo sapiens GN=CNTNAP3B PE=2 SV=2 (Range: 1051-1263)  ali follow..  16  162......................................................................................................................VNADRRDSAVMGGVIA--VIFILLCITAIAIRIYQQR----KLRKENESKVSKKE....... 211
19 -10.200sp|Q9C0A0|CNTP4_HUMAN(removed signalp:1-25) Contactin-associated protein-like 4 OS=Homo sapiens GN=CNTNAP4 PE=1 SV=3 (Range: 1051-1283)  ali follow..  16  154..................................................................................................................REPLANAIKSDSAVIGGLIA-VVIFILLCITAIAVRIYQQK----RLYKRSEAKRSENVDSKEYF. 232
20 -10.000sp|Q86YL7|PDPN_HUMAN(removed signalp:1-22) Podoplanin OS=Homo sapiens GN=PDPN PE=1 SV=3  ali follow..  18  59.........................................................................................EDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYS................. 139
21 -9.980sp|P60602|ROMO1_HUMAN Reactive oxygen species modulator 1 OS=Homo sapiens GN=ROMO1 PE=1 SV=1  ali follow..  12  7.................................................................................................................PYGQSQPSCFDRVKM--GFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF. 70
22 -9.950sp|P58400|NRX1B_HUMAN Neurexin-1-beta OS=Homo sapiens GN=NRXN1 PE=2 SV=1  ali follow..  22  354.....................................................................................................................GSAEVIRESSSTTGMVVGIVAAAALCILILLCAMNKCRNRDEGSYHVDESRNYKKNKDKEYYV 442
23 -9.910sp|Q6UVK1|CSPG4_HUMAN(removed signalp:1-29) Chondroitin sulfate proteoglycan 4 OS=Homo sapiens GN=CSPG4 PE=1 SV=2 (Range: 1951-2250)  ali follow..  22  185.......................................................................PYNAARPYSVALLSVPEAARTEAGKPESSTPTGEPGPMASSPEPAVAKGGFLSFLEMFSVIIPMCLVLLLLALIL--LLFYLRKRNKTGKHDVTAKPRNGLAGDTETF. 296
24 -9.910sp|Q96PD2|DCBD2_HUMAN(removed signalp:1-66) Discoidin, CUB and LCCL domain-containing protein 2 OS=Homo sapiens GN=DCBLD2 PE=1 SV=1 (Range: 451-709)  ali follow..  39  10..............................................................................................................................DVLAAVLVPVLVMVLTTLILILVCA-NRKKKTEGTYDLPYKGMKQFLPAKA... 71
25 -9.860sp|Q9HBW1|LRRC4_HUMAN(removed signalp:1-40) Leucine-rich repeat-containing protein 4 OS=Homo sapiens GN=LRRC4 PE=1 SV=2 (Range: 451-613)  ali follow..  16  1..........................................................................................TTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVA--VTLLAAAMLIVF--YKLRKRHQ------QRSTVTAARTVEI.. 78
26 -9.300sp|Q9NZU0|FLRT3_HUMAN(removed signalp:1-28) Leucine-rich repeat transmembrane protein FLRT3 OS=Homo sapiens GN=FLRT3 PE=1 SV=1 (Range: 451-621)  ali follow..  20  19.................................................................................................IETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVA-LVTIALLALVCWYVHRNGNCAYSKGRRR-YAEAGTKK... 104
27 -9.240sp|Q9BV81|TMM93_HUMAN Transmembrane protein 93 OS=Homo sapiens GN=TMEM93 PE=1 SV=1  ali follow..  13  1.............................................................................................MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFT 95
28 -9.230sp|Q9Y561|LRP12_HUMAN(removed signalp:1-32) Low-density lipoprotein receptor-related protein 12 OS=Homo sapiens GN=LRP12 PE=1 SV=1 (Range: 451-750)  ali follow..  19  8............................................................................................................................PTRVITAAVIGSLI---CGLLLVIALLYSLRMFERRSFEVEAELLRREAPPS--YG 68
29 -9.160sp|P23471|PTPRZ_HUMAN(removed signalp:1-24) Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens GN=PTPRZ1 PE=1 SV=4 (Range: 1351-1650)  ali follow..  15  135NGLSQKHNDGKEENDIQTGSALLPLSPESKAWAVLTSDEESGSGQGTSDSLNENETSTDFSFADTNEKDADGILAAGDSEITPGFPQSPTSSVTSENSEVFHVSEAEASNSSHESRIGLAE--EKKAVIPLVIVSALT-FICLVVLVGILIY--------------RKCFQ---TAHFY. 298
30 -9.030sp|P05556|ITB1_HUMAN(removed signalp:1-20) Integrin beta-1 OS=Homo sapiens GN=ITGB1 PE=1 SV=2 (Range: 601-778)  ali follow..  28  108...........................................................................................................................DIIPIVAGVVAG-LIGLALLLIWKLLMIIHEKEKMNAKWDTGENPIYKSAVTT.... 169
31 -9.010sp|A6NHS7|YL019_HUMAN(removed signalp:1-24) MANSC domain-containing protein ENSP00000370673 OS=Homo sapiens PE=4 SV=2  ali follow..  135KQTTTINGMLPSTEAPSSTTHQDLVVNTNSTSYSKELTTDFWARFTSLNESITTKINKVSPSTDFISNPDNKTISPFFEPIDTKLSHMPVPPGLNSSKQLLNKTKGYNSRNHTSANEDEVSVTSKTWLVSVALCTSVI--CCIVILAS---YKPGQRKSGSLQIKNRNHMKENS...... 315

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.