current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q99490|AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=AGAP2 PE=1 SV=2 (Range: 451-750), from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst QTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSLast
1 -116.000sp|Q99490|AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=AGAP2 PE=1 SV=2 (Range: 451-750)  ali  100  1QTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPS 300
2 -88.800sp|Q96P47|AGAP3_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=AGAP3 PE=1 SV=2 (Range: 151-450)  ali follow..  53  2................QFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFR--NASEVPMVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASIPAVHGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFTSRKGADLDREKKAAECKVDSIGSGRAIPIKQGILLKRSGKSLNKEWKKKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPGKRLPRATPATAPG 291
3 -80.900sp|Q9UPQ3|AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=AGAP1 PE=1 SV=4 (Range: 151-450)  ali follow..  52  1...................................SFQTVYHYYSRMANYR--NTSEIPLVLVGTQDAISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPSHSSVCSASQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPI 270
4 -52.100sp|Q99490|AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=AGAP2 PE=1 SV=2 (Range: 301-600)  ali follow..  100  151QTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAG......................................................................................................................................................... 297
5 -50.600sp|Q96P47|AGAP3_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=AGAP3 PE=1 SV=2 (Range: 1-300)  ali follow..  54  136QSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFR--NASEVPMVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAAS.......................................................................................................................................................... 279
6 -49.000sp|Q9NP90|RAB9B_HUMAN(removed signalp:1-19) Ras-related protein Rab-9B OS=Homo sapiens GN=RAB9B PE=1 SV=1  ali follow..  20  35RFVTLQIWDTAGQERFKFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADKDPEHFPFVVLGNKVDKE---DRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSS............................................................................................................................................................. 180
7 -48.700sp|A6NDJ8|RB43L_HUMAN Putative Rab-43-like protein ENSP00000330714 OS=Homo sapiens PE=5 SV=3  ali follow..  18  34KRVKLQIWDTAGQERFRYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAG---SNIVQLLIGN--KSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEG............................................................................................................................................................. 176
8 -48.600sp|Q9UPQ3|AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=AGAP1 PE=1 SV=4 (Range: 1-300)  ali follow..  44  116QSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYR--NTSEIPLVLVGTQDAISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPT................................................................................................................. 300
9 -48.400sp|P11234|RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1  ali follow..  20  60EEVQIDILDTAGQEDYAYFRSGEGFLLVFSITEHESFTATAEFREQILRVKA-EEDKIPLLVVGN--KSDLEERRQVPVEEARSKAEEWG-VQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKER.............................................................................................................................................................. 202
10 -48.400sp|A6NIZ1|RP1BL_HUMAN Ras-related protein Rap-1b-like protein OS=Homo sapiens PE=2 SV=1  ali follow..  18  49QQCMLEILDTAGTEQFTYMKNGQGFALVYSITAQSTFNDLQDLREQILRVK--DTDDVPMILVGN--KCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS......................................................................................................................................................................... 180
11 -48.300sp|P61224|RAP1B_HUMAN Ras-related protein Rap-1b OS=Homo sapiens GN=RAP1B PE=1 SV=1  ali follow..  18  49QQCMLEILDTAGTEQFTYMKNGQGFALVYSITAQSTFNDLQDLREQILRVK--DTDDVPMILVGN--KCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS......................................................................................................................................................................... 180
12 -48.300sp|P62070|RRAS2_HUMAN Ras-related protein R-Ras2 OS=Homo sapiens GN=RRAS2 PE=1 SV=1  ali follow..  18  60RAARLDILDTAGQEEFGYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVK--DRDEFPMILIGN--KADLDHQRQVTQEEGQQLARQLK-VTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKG................................................................................................................................................................. 198
13 -48.300sp|P62834|RAP1A_HUMAN Ras-related protein Rap-1A OS=Homo sapiens GN=RAP1A PE=1 SV=1  ali follow..  19  49QQCMLEILDTAGTEQFTYMKNGQGFALVYSITAQSTFNDLQDLREQILRVK--DTEDVPMILVGN--KCDLEDERVVGKEQGQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKS......................................................................................................................................................................... 180
14 -48.200sp|O95661|DIRA3_HUMAN GTP-binding protein Di-Ras3 OS=Homo sapiens GN=DIRAS3 PE=2 SV=1  ali follow..  12  83GVLSLHITDSKSGDGNRVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGN--KSDDTH-REVALNDGATCAMEWN-CAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLD............................................................................................................................................................... 224
15 -48.000sp|P11233|RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens GN=RALA PE=1 SV=1  ali follow..  19  60EEVQIDILDTAGQEDYAYFRSGEGFLCVFSITEMESFAATADFREQILRVK--EDENVPFLLVGN--KSDLEDKRQVSVEEAKNRAEQWN-VNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRER............................................................................................................................................................. 202
16 -47.500sp|Q96HU8|DIRA2_HUMAN GTP-binding protein Di-Ras2 OS=Homo sapiens GN=DIRAS2 PE=1 SV=1  ali follow..  20  53SICTLQITDTTGSHQFPSISKGHAFILVYSITSRQSLEELKPIYEQICEIKG-DVESIPIMLVGN--KCDESPSREVQSSEAEALARTWK-CAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGK.............................................................................................................................................................. 195
17 -47.400sp|P10301|RRAS_HUMAN Ras-related protein R-Ras OS=Homo sapiens GN=RRAS PE=1 SV=1  ali follow..  22  75IPARLDILDTAGQEEFGYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVK--DRDDFPVVLVGN--KADLESQRQVPRSEASAFGASHH-VAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGG................................................................................................................................................................... 211
18 -47.400sp|Q96S79|RSLAB_HUMAN Ras-like protein family member 10B OS=Homo sapiens GN=RASL10B PE=2 SV=1  ali follow..  18  51HVHDLQILDFPPISAFPGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGN--KRDLQRGRVIPRWNVSHLVRKTWKCGYVECSAKYNWHILLLFSELLKSVGCARCKHVHAALRFQGALRRNR.................................................................................................................................................................. 199
19 -47.300sp|Q99578|RIT2_HUMAN GTP-binding protein Rit2 OS=Homo sapiens GN=RIT2 PE=1 SV=1  ali follow..  18  66EPAYLDILDTAGQAEFTYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVR--HTYEIPLVLVGN--KIDLEQFRQVSTEEGLSLAQEYN-CGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDSLWKKLKGS............................................................................................................................................................. 208
20 -47.200sp|Q92963|RIT1_HUMAN GTP-binding protein Rit1 OS=Homo sapiens GN=RIT1 PE=1 SV=1  ali follow..  20  67EPANLDILDTAGQAEFTYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVR--RTDDTPVVLVGN--KSDLKQLRQVTKEEGLALAREFS-CPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKK....................................................................................................................................................... 215
21 -46.800sp|P10114|RAP2A_HUMAN Ras-related protein Rap-2a OS=Homo sapiens GN=RAP2A PE=1 SV=1  ali follow..  22  49SPSVLEILDTAGTEQFAYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVK--RYEKVPVILVGN--KVDLESEREVSSSEGRALAEEWG-CPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSA......................................................................................................................................................................... 179
22 -46.600sp|Q9NYS0|KBRS1_HUMAN NF-kappa-B inhibitor-interacting Ras-like protein 1 OS=Homo sapiens GN=NKIRAS1 PE=1 SV=1  ali follow..  16  53VKEQLHLYDTRGLQEGVYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFK--DKKEVAIVVLGN--KIDLSEQRQVDAEVAQQWAKSEK-VRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN................................................................................................................................................................ 192
23 -46.600sp|Q9Y3L5|RAP2C_HUMAN Ras-related protein Rap-2c OS=Homo sapiens GN=RAP2C PE=1 SV=1  ali follow..  22  49SPSVLEILDTAGTEQFAYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVK--RYEKVPLILVGN--KVDLEPEREVMSSEGRALAQEWG-CPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTT......................................................................................................................................................................... 179
24 -46.600sp|P61225|RAP2B_HUMAN Ras-related protein Rap-2b OS=Homo sapiens GN=RAP2B PE=1 SV=1  ali follow..  20  49SPSVLEILDTAGTEQFAYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVK--RYERVPMILVGN--KVDLEGEREVSYGEGKALAEEWS-CPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSA......................................................................................................................................................................... 179
25 -46.300sp|Q15382|RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens GN=RHEB PE=1 SV=1  ali follow..  18  52QEYHLQLVDTAGQDEYSYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMV--GKVQIPIMLVGN--KKDLHMERVISYEEGKALAESWN-AAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS........................................................................................................................................................................... 180
26 -46.100sp|Q8TAI7|REBL1_HUMAN GTPase RhebL1 OS=Homo sapiens GN=RHEBL1 PE=1 SV=1  ali follow..  17  52DEFHLHLVDTAGQDEYSFIIGVHGYVLVYSVTSLHSFQVIESLYQKLHEGH--GKTRVPVVLVGN--KADLSPEREVQAVEGKKLAESWG-ATFMESSARENQLTQGIFTKVIQEIARVENSYGQERR............................................................................................................................................................................ 179
27 -46.100sp|Q92737|RSLAA_HUMAN Ras-like protein family member 10A OS=Homo sapiens GN=RASL10A PE=2 SV=1  ali follow..  19  51AVYDLSIRDPGGPEEWPSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGN--KRDRQRLRFGPRRALAALVRRGWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPAR................................................................................................................................................................... 199
28 -46.000sp|Q96A58|RERG_HUMAN Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens GN=RERG PE=1 SV=1  ali follow..  20  52EVVSMEILDTAGQEDTGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIK--KPKNVTLILVGN--KADLDHSRQVSTEEGEKLATELA-CAFYECSACTGGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLTKISS........................................................................................................................................................ 199
29 -45.800sp|Q9NYR9|KBRS2_HUMAN NF-kappa-B inhibitor-interacting Ras-like protein 2 OS=Homo sapiens GN=NKIRAS2 PE=1 SV=1  ali follow..  16  53VREQVRFYDTRGLRDGACFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSK--DKKEVTIVVLGN--KCDLQEQRRVDPDVAQHWAKSEK-VKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGS.................................................................................................................................................................... 188
30 -45.500sp|O95057|DIRA1_HUMAN GTP-binding protein Di-Ras1 OS=Homo sapiens GN=DIRAS1 PE=1 SV=1  ali follow..  18  53SVCTLQITDTTGSHQFPSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKG-SVEDIPVMLVGNKCDET---QREVDTREAQAVAQEWK-CAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGK.............................................................................................................................................................. 194
31 -45.500sp|P01116|RASK_HUMAN GTPase KRas OS=Homo sapiens GN=KRAS PE=1 SV=1  ali follow..  17  49ETCLLDILDTAGQEEYSYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVK--DSEDVPMVLVGN--KCDLPS-RTVDTKQAQDLARSYG-IPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKK.................................................................................................................................................................. 185
32 -45.500sp|P01112|RASH_HUMAN GTPase HRas OS=Homo sapiens GN=HRAS PE=1 SV=1  ali follow..  16  49ETCLLDILDTAGQEEYSYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVK--DSDDVPMVLVGN--KCDLAA-RTVESRQAQDLARSYG-IPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSC................................................................................................................................................................... 184
33 -45.300sp|P01111|RASN_HUMAN GTPase NRas OS=Homo sapiens GN=NRAS PE=1 SV=1  ali follow..  16  49ETCLLDILDTAGQEEYSYMRTGEGFLCVFAINNSKSFADINLYREQIKRVK--DSDDVPMVLVGNKCDLP---TRTVDTKQAHELAKSYG-IPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGL................................................................................................................................................................... 184
34 -44.500sp|Q7Z444|RASE_HUMAN GTPase ERas OS=Homo sapiens GN=ERAS PE=2 SV=1  ali follow..  17  87GDCILNVLDTAGQAIHRCLAVCDGVLGVFALDDPSSLIQLQQIWATW-----GPHPAQPLVLVGN--KCDLVTTAGDAHAAAAALAHSWG-AHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKAT.............................................................................................................................................................. 225
35 -44.500sp|O14807|RASM_HUMAN Ras-related protein M-Ras OS=Homo sapiens GN=MRAS PE=1 SV=2  ali follow..  18  59QWAILDVLDTAGQEEFSYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVK--DRESFPMILVAN--KVDLMHLRKITREQGKEMATKHN-IPYIETSAKDPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHK............................................................................................................................................................. 202
36 -44.400sp|Q9BPW5|RSLBB_HUMAN Ras-like protein family member 11B OS=Homo sapiens GN=RASL11B PE=2 SV=1  ali follow..  20  79ETLALQVQDTPGIQVHECIRWADAVVIVFSITDYKSYELISQLHQHVQQLH--LGTRLPVVVVAN--KADLLHIKQVDPQLGLQLASMLG-CSFYEVSVSENYNVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSPNMQ............................................................................................................................................................. 228
37 -44.300sp|Q9NYN1|RASLC_HUMAN Ras-like protein family member 12 OS=Homo sapiens GN=RASL12 PE=1 SV=1  ali follow..  17  66QPVHLRVMDTADLDTPRYLNWAHAFLVVYSVDSRQSFDSSSSYLELLALHAKETQRSIPALLLGN--KLDMAQYRQVTKAEGVALAGRFG-CLFFEVSACLDFHVQHVFHEAVREARRELEKSPLTRPLFISEERALPHQAPLTARHGLASCTFNTLSTINLKEMPTVAQAKLVTVKSSRAQSKRKAPTLTLLK.......................................................................................................... 261
38 -44.100sp|Q96AH8|RAB7B_HUMAN Ras-related protein Rab-7b OS=Homo sapiens GN=RAB7B PE=2 SV=1  ali follow..  21  55TTLKLQIWDTGGQERFRFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGN--KIDLAD-RKVPQEVAQGWCREKD-IPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSR.............................................................................................................................................................. 197
39 -43.800sp|Q9BW83|IFT27_HUMAN Intraflagellar transport protein 27 homolog OS=Homo sapiens GN=IFT27 PE=1 SV=1  ali follow..  20  56DSVELFIFDSAGKELFSLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQA--PGISLPGVLVGN--KTDLAGRRAVDSAEARAWALGQG-LECFETSVKEMENFEAPFHCLAKQFHQLYREK................................................................................................................................................................................. 178
40 -43.300sp|Q9H628|RERGL_HUMAN Ras-related and estrogen-regulated growth inhibitor-like protein OS=Homo sapiens GN=RERGL PE=2 SV=1  ali follow..  17  50KQLNLEIYDPCSQTQKSELHWADGFVIVYDISDRSSFAFAKALIYRIREPQTKRAVESAVFLVGN--KRDLCHVREVGWEEGQKLALENR-CQFCELSAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMAKLINN................................................................................................................................................................ 196
41 -42.900sp|P51151|RAB9A_HUMAN Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1  ali follow..  22  54HFVTMQIWDTAGQERFRFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADKEPESFPFVILGNKIDIS---ERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSS............................................................................................................................................................. 199
42 -42.700sp|Q6T310|RSLBA_HUMAN Ras-like protein family member 11A OS=Homo sapiens GN=RASL11A PE=2 SV=1  ali follow..  15  73DQLSLQIQDTPGGVQIQCVQWAEGFLLVYSITDYDSYLSIRPLYQHIRKVH--PDSKAPVIIVGN--KGDLLHARQVQTQDGIQLANELG-SLFLEISTSENEDVCDVFQHLCKEVSKMHGLSGERRRASIIPRPRSPNMQD.............................................................................................................................................................. 222
43 -42.400sp|Q96D21|RHES_HUMAN GTP-binding protein Rhes OS=Homo sapiens GN=RASD2 PE=1 SV=1  ali follow..  21  65DMYQLDILDTSGNHPFPSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSKEAAELPMVICGN--KNDHELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRP.............................................................................................................................................................. 216
44 -42.400sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1  ali follow..  16  55KTIKLQIWDTAGQERFRYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYAS---ENVNKLLVGN--KSDLTTKKVVDNTTAKEFADSLG-IPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPA............................................................................................................................................................. 196
45 -42.400sp|Q86YS6|RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens GN=RAB43 PE=1 SV=1  ali follow..  18  65KRVKLQIWDTAGQERFRYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAG---SNIVQLLIGN--KSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEG............................................................................................................................................................. 207
46 -42.400sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2  ali follow..  16  55KTIKLQIWDTAGQERFWYYRGAHGFLVVYDVTDQESYANVKQWLQEIDRHAS---ENVNKLLVGN--KSDLTTKKVVDNTTAKEFADSLG-IPFLETSAKNATNVEQAFMTMAAEIKKQMGPGAASGGERPNLKIDSTPVKPA............................................................................................................................................................. 196
47 -42.100sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1  ali follow..  18  55KKIKLQVWDTAGQERFKYYRGAMGIILVYDITDEKSFENIQNWMKSIKENAS---AGVERLLLGN--KCDMEAKRKVQKEQADKLAREHG-IRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKN............................................................................................................................................................. 196
48 -42.000sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1  ali follow..  14  56KKIKLQIWDTAGQERFHYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHAN---EDVERMLLGN--KCDMDDKRVVPKGKGEQIAREHG-IRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKS............................................................................................................................................................. 197
49 -42.000sp|A4D1S5|RAB19_HUMAN Ras-related protein Rab-19 OS=Homo sapiens GN=RAB19 PE=2 SV=2  ali follow..  15  64KKVKMQVWDTAGQERFRYYRSAHAAIIAYDLTRRSTFESIPHWIHEIEKYGA---ANVVIMLIGN--KCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKESKNIEEVFVLMAKELIARNSLHLYGESALN......................................................................................................................................................................... 194
50 -41.900sp|P55042|RAD_HUMAN GTP-binding protein RAD OS=Homo sapiens GN=RRAD PE=1 SV=2  ali follow..  20  136EEASLMVYDIWEQDGGRCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRAR--QTDDVPIILVGN--KSDLVRSREVSVDEGRACAVVFD-CKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKA............................................................................................................................................................. 278
51 -41.900sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1  ali follow..  16  55RLVTMQIWDTAGQERFQFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASRDPENFPFVVLGN--KIDLENRQVATKRAQAWCYSK-NNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAES......................................................................................................................................................... 204
52 -41.900sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3  ali follow..  16  58KTIKLQIWDTAGQERFRYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYAS---ENVNKLLVGN--KCDLTTKKVVDYTTAKEFADSLG-IPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQ............................................................................................................................................................. 199
53 -41.800sp|O75628|REM1_HUMAN GTP-binding protein REM 1 OS=Homo sapiens GN=REM1 PE=1 SV=2  ali follow..  20  126EDTTLVVVDTWEAEKLDCLQGGSAYVIVYSIADRGSFESASELRIQLR--RTHQADHVPIILVGN--KADLARCREVSVEEGRACAVVFD-CKFIETSATLQHNVAELFEGVVRQLRLRRRDSAAKEPPAPRRPASLAQRARR............................................................................................................................................................. 270
54 -41.800sp|Q13636|RAB31_HUMAN Ras-related protein Rab-31 OS=Homo sapiens GN=RAB31 PE=1 SV=1  ali follow..  16  52ELHKFLIWDTAGQERFHYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGP---ENIVMAIAGN--KCDLSDIREVPLKDAKEYAESIG-AIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRR.............................................................................................................................................................. 192
55 -41.700sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1  ali follow..  14  55KRIKLQIWDTAGQERFRYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHAS---ADVEKMILGN--KCDVNDKRQVSKERGEKLALDYG-IKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSS......................................................................................................................................................... 200
56 -41.700sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2  ali follow..  15  55KKIKLQIWDTAGQERFRYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHAS---SDVERMILGN--KCDMNDKRQVSKERGEKLAIDYG-IKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS......................................................................................................................................................... 200
57 -41.600sp|Q9Y272|RASD1_HUMAN Dexamethasone-induced Ras-related protein 1 OS=Homo sapiens GN=RASD1 PE=1 SV=1  ali follow..  20  70EVYQLDILDTSGNHPFPSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSKENVDVPLVICGN--KGDRDFYREVDQREIEQLVGDDPRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKAL............................................................................................................................................................. 222
58 -41.600sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2  ali follow..  18  52ELHKFLIWDTAGQERFRYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGP---PNIVVAIAGN--KCDLIDVREVMERDAKDYADSIH-AIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS.............................................................................................................................................................. 192
59 -41.500sp|P55040|GEM_HUMAN GTP-binding protein GEM OS=Homo sapiens GN=GEM PE=1 SV=1  ali follow..  20  123ESATIILLDMKGENEWHCMQVGDAYLIVYSITDRASFEKASELRIQLRRAR--QTEDIPIILVGN--KSDLVRCREVSVSEGRACAVVFD-CKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKA............................................................................................................................................................. 266
60 -41.400sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2  ali follow..  19  56EKVKLQIWDTAGQERFRYYRSANALILTYDITCEESFRCLPEWLREIEQYAS---NKVITVLVGN--KIDLAERREVSQQRAEEFSEAQD-MYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCN......................................................................................................................................................... 201
61 -41.200sp|Q9H0T7|RAB17_HUMAN Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2  ali follow..  18  65TSLKLEIWDTAGQEKYHYFRGANAALLVYDITRKDSFLKAQQWLKDLEEEL--HPGEVLVMLVGN--KTDLSQEREVTFQEGKEFADSQK-LLFMETSAKLNHQVSEVFNTVAQELLQRSDEEGQALRGDAAVALNKGPARQA............................................................................................................................................................. 207
62 -41.200sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1  ali follow..  17  55IKVRIQIWDTAGQERYQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAP---EGVQKILIGN--KADEEQKRQVGREQGQQLAKEYG-MDFYETSACTNLNIKESFTRLTELVLQAHRKELEGLRMRA......................................................................................................................................................................... 184
63 -41.200sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1  ali follow..  17  55EKVKLQIWDTAGQERFRYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNC----DDVCRILVGN--KNDDPERKVVETEDAYKFAGQMG-IQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKR......................................................................................................................................................... 199
64 -41.100sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2  ali follow..  20  68TTVKFEIWDTAGQERYHYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQAS---PNIVIALAGN--KADLASKRAVEFQEAQAYADDNS-LLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPAS............................................................................................................................................................. 209
65 -41.000sp|Q14964|RB39A_HUMAN Ras-related protein Rab-39A OS=Homo sapiens GN=RAB39 PE=2 SV=2  ali follow..  20  60KRIKLQLWDTAGQERFRYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYV--QPFRIVFLLVGH--KCDLASQRQVTREEAEKLSADCG-MKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDG.......................................................................................................................................................................... 189
66 -40.900sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1  ali follow..  18  69KRIKLQIWDTAGQERYRYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSW---DNAQVLLVGN--KCDMEDERVVSSERGRQLADHLG-FEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQ....................................................................................................................................................... 216
67 -40.900sp|O95716|RAB3D_HUMAN Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1  ali follow..  18  69KRIKLQIWDTAGQERYRYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSW---DNAQVILVGN--KCDLEDERVVPAEDGRRLADDLG-FEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSG......................................................................................................................................................................... 198
68 -40.800sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2  ali follow..  20  67TTVKFEIWDTAGQERYHYYRGAQAAIVVYDITNEESFARAKNWVKELQRQAS---PNIVIALSGN--KADLANKRAVDFQEAQSYADDNS-LLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPT............................................................................................................................................................. 208
69 -40.800sp|P20337|RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2  ali follow..  16  69KRVKLQIWDTAGQERYRYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSW---DNAQVILVGN--KCDMEEERVVPTEKGQLLAEQLG-FDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSML......................................................................................................................................................................... 198
70 -40.800sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3  ali follow..  17  77VRVKLQIWDTAGQERFRYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQ---RDVVIMLLGN--KADMSSERVIRSEDGETLAREYG-VPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYVESQKKRSSCCS.......................................................................................................................................................... 221
71 -40.800sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1  ali follow..  21  67TTVKFEIWDTAGQERYHYYRGAQAAIVVYDITNQETFARAKTWVKELQRQAS---PSIVIALAGN--KADLANKRMVEYEEAQAYADDNS-LLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQN............................................................................................................................................................. 208
72 -40.700sp|P51159|RB27A_HUMAN Ras-related protein Rab-27A OS=Homo sapiens GN=RAB27A PE=1 SV=3  ali follow..  19  66QRIHLQLWDTAGQERFRFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHA--YCENPDIVLCGN--KSDLEDQRVVKEEEAIALAEKYG-IPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKG.................................................................................................................................................... 217
73 -40.600sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1  ali follow..  16  55NKAKLAIWDTAGQERFRYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYC--TRNDIVNMLVGNKIDKE---NREVDRNEGLKFARKHS-MLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGG............................................................................................................................................................. 196
74 -40.500sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1  ali follow..  14  53KQIKLQIWDTAGQESFRYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSN---SNMVIMLIGN--KSDLESRREVKKEEGEAFAREHG-LIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEA......................................................................................................................................................................... 182
75 -40.400sp|P51157|RAB28_HUMAN Ras-related protein Rab-28 OS=Homo sapiens GN=RAB28 PE=1 SV=2  ali follow..  17  60LNVTLQIWDIGGQTIGGYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGN--KIDLEHMRTIKPEKHLRFCQENG-FSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQR......................................................................................................................................................................... 192

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 4 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.