current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|P08908|5HT1A_HUMAN 5-hydroxytryptamine receptor 1A OS=Homo sapiens GN=HTR1A PE=1 SV=3, from H.sapiens

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFCRQLast
1 -106.0004iaq_A mol:protein length:403 Chimera protein of human 5-hydroxytryptamine receptor 1B and E. Coli soluble cytochrome b562  ali model follow..  35  1................GGTCSAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKL--EDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCTS. 403
2 -106.0005v54_A mol:protein length:395 5-hydroxytryptamine receptor 1B,OB-1 fused 5-HT1b receptor,5-hydroxytryptamine receptor 1B  ali model follow..  39  8..............................ISLPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIADLEDRWRTLEDNLRVIERAAN---AAEVREALTRMRAAAEDAQRATPPALEDRSPASPEMEDFRHGFDILVGQIDDALRLADEGRVAEAQAAAEELRTTRNAYIQKYLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCTS. 395
3 -105.0005wiu_A mol:protein length:422 D(4) dopamine receptor, soluble cytochrome b562 chimera  ali model follow..  25  3TTMGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGAWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR--DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDAANEGKVKEAQAAAEQLKTTRNAYIQKYLAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALCPA-CSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC... 422
4 -104.0006g79_S mol:protein length:364 5-hydroxytryptamine receptor 1B  ali model follow..  40  2....................SAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSV--------------------------------------------TSINSRVPDVPSESGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCTSE 359
5 -104.0005tud_A mol:protein length:457 5-hydroxytryptamine receptor 2B,Soluble cytochrome b562 chimera  ali model follow..  24  10IFCLVFADYKDDDDGAPTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFAMWPLPLVLCPAWLFLDVLFSTASIWHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKL--EDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSNQTTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRAT 434
6 -103.0006bqg_A mol:protein length:452 5-hydroxytryptamine receptor 2C,Soluble cytochrome b562  ali model follow..  23  5IALSYIFCLVFADYKDDDDGAPTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQAADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKL--EDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKNQKLMEKLLNVFVWIGYVNSGINPLVYTLFNKIYRRAFSNYLRCNYKVE 428
7 -102.0005dsg_A mol:protein length:422 Muscarinic acetylcholine receptor M4,Endolysin,Endolysin,Muscarinic acetylcholine receptor M4  ali model follow..  24  2........................PSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNRQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVNIFEMLRIDEGGGSGGDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAAETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYQMAARERKVTRTIFAILLAFILTWTPYNVMVLVNTFCQSC--IPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNI 410
8 -102.0004u15_A mol:protein length:418 Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3  ali model follow..  25  7..............................HTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGGGSGGDEAEKLFNQDVDARNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSC--IPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTLLLCQCDKR 406
9 -102.0005wf5_A mol:protein length:504 Human A2a adenosine receptor T4L chimera  ali model follow..  25  1MKTIALSYIFCLVFADYKDDDDAMGQPVGAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAANIAVGVLAIPFAIT--ISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNTGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYRSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ 488
10 -102.0006cm4_A mol:protein length:430 D(2) dopamine receptor, endolysin chimera  ali model follow..  29  2.....................................YYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASALNLCAISIDRYTAVAMPMLYNTRYSSKRVTVMISIVWVLSFTISCPLLFGLNN-----ADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKLSQQKEKKATQMAAIVAGVFIICWLPFFITHILNIHCD--CNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC..... 430
11 -101.0004eiy_A mol:protein length:447 Adenosine receptor A2a/Soluble cytochrome b562 chimera  ali model follow..  24  1MKTII-----ALSYIFCLVFADYKDDDDGAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAIT--ISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKNEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ 431
12 -101.0006MH8 Entity 1(prereleased)  ali follow..  24  1MKTII-----ALSYIFCLVFADYKDDDDGAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAIT--ISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKNEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ 431
13 -99.5005mzj_A mol:protein length:434 Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a  ali model follow..  26  1....................ADYKDDDDGAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAIT--ISTGFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKNEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ 416
14 -96.1005uen_A mol:protein length:416 Adenosine receptor A1,Soluble cytochrome b562,Adenosine receptor A1  ali model follow..  24  6...............................ISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFH--TCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAAKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKNEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKELKIAKSLALILFLFALSWLPLHILNCITLFCPS-CHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQ 409
15 -96.1003rze_A mol:protein length:452 Histamine H1 receptor, Lysozyme chimera  ali model follow..  27  1............................TTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQREDKCETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAESLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCKNC--CNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHIRSGEN 448
16 -96.0003pbl_A mol:protein length:481 D(3) dopamine receptor, Lysozyme chimera  ali model follow..  26  4.DDDDGAPASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGVWNFSRICCDVFVTLDVMMCTASIWNLCAISIDRYTAVVMPVHYQHGTGQSSVALMITAVWVLAFAVSCPLLFGFN----TTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAERMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQT-CHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSCGRPLE 477
17 -95.4003d4s_A mol:protein length:490 Beta-2 adrenergic receptor/T4-lysozyme chimera  ali model follow..  26  7.DAMGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIWTLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKSRWYNQTPNRAKRVITTFRTGTWDAYKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNL--IRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCLRRSSL 483
18 -95.1004daj_A mol:protein length:479 Muscarinic acetylcholine receptor M3, Lysozyme  ali model follow..  25  7..............................HTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSC--IPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTLLLCQCDKR 449
19 -94.0003uon_A mol:protein length:467 Human M2 muscarinic acetylcholine, receptor T4 lysozyme fusion protein  ali model follow..  25  2..............DDSTDSSDNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRINIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPC--IPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNI 463
20 -93.4003p0g_A mol:protein length:501 Beta-2 adrenergic receptor, Lysozyme  ali model follow..  25  7.DAMGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNL--IRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCLRRSSL 483
21 -93.1004u14_A mol:protein length:460 Muscarinic acetylcholine receptor M3,Endolysin,Muscarinic acetylcholine receptor M3  ali model follow..  25  7..............................HTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNCFEMLRIDEGLRLKIYKDCEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKTNSLRMLQQKRWDEAAVNLAKSRWYNQCPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSC--IPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTLLLCQCDKR 449
22 -92.8003v2w_A mol:protein length:520 Sphingosine 1-phosphate receptor 1, Lysozyme chimera  ali model follow..  19  32....SSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGA-TTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNN-FRLFLLISACWVISLILGGLPIMGWNCISALSSCSTV-LPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDETNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYASRSSENVALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMGRPLEVL 498
23 -92.0005cxv_A mol:protein length:515 Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1  ali model follow..  23  15FADYKDDDDAAAQTSAPPAVSPQITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASQASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDC--VPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKR 489
24 -91.5004mqs_A mol:protein length:351 Muscarinic acetylcholine receptor M2  ali model follow..  30  6.DENLYFQGLEMDDSTDSSDNSLALTSPYLEKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVAN-----------------------------------------------------------------------------------------QDPVSTRKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPC--IPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNI 339
25 -90.8005gli_A mol:protein length:464 Endothelin Receptor Subtype-B  ali model follow..  17  4LAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLYIIYKNKCMRNGPNILIASLALGDLLHIVIAIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDVQKTAFMQFYATAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKNIFEMLRIDEGGGSGGDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLNDHLKQRREVAKTVFCLVLVFALCWLPLHLARILKLTLYELLSFLLVLDYIGINMASLNSCANPIALYLVSKRFKNAFKSALCCWAQSP 456
26 -90.7003kj6_A mol:protein length:366 Beta-2 adrenergic receptor  ali model follow..  29  2...FGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGR----------------------------------------------------------------------------TGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNL--IRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCLRRSSL 348
27 -90.1004z34_A mol:protein length:464 Lysophosphatidic acid receptor 1, Soluble cytochrome b562  ali model follow..  15  33.QFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNT-RRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTR-MSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAPLYSDSYLVFWAI-FNLVTFVVMVVLYAHIFGYVADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLE------DKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQC--DVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILGRPLEVL 442
28 -89.7004z36_A mol:protein length:459 Lysophosphatidic acid receptor 1,Soluble cytochrome b562  ali model follow..  16  33.QFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNT-RRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTR-MSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAPLYS-CSYLVFWAIFNLVTFVVMVVLYAHIFGYVADLEDNWETLNDNLKVIEKADNAAQV-----------KDALTKMRAAALDAQKGGSGGSDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDCCCPQC--DVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILGRPLEVL 437
29 -89.7002y00_A mol:protein length:315 BETA-1 ADRENERGIC RECEPTOR  ali model follow..  38  7...............................SQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKID-----------------------------------------------------------------------------------------------RASKRKTSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDL--VPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLAFPRKAD 306
30 -87.8004gbr_A mol:protein length:309 Beta-2 adrenergic receptor  ali model follow..  35  1...............................DEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKI--------------------------------------------------------------------------------------------------------DKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNL--IRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCLRRSSL 291
31 -87.2005g53_A mol:protein length:314 ADENOSINE RECEPTOR A2A  ali model follow..  31  2...............................PIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAIT--ISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAHDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMES----------------------------------------------------------------------------------------------QPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLEN 310
32 -87.1005tgz_A mol:protein length:452 Cannabinoid receptor 1,Flavodoxin,Cannabinoid receptor 1  ali model follow..  20  1..............GGGRGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCPSYHFIGSLAVADLLGSVIFVYSFIDFHVFH-RKDSRNVFLFKLGGVTASFTASVGSLFLAAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQS-VCSDIFPHIDKTYLMFWIGVVSVLLLFIVYAYMYILWKAHSHAVAKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKDPRAARDDIVGWAHDVRGAIPDQARMDIELAKTLVLILVVLIICWGPLLAIMVYDVFG-KMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFP...... 441
33 -86.8005glh_A mol:protein length:498 Endothelin Receptor Subtype-B  ali model follow..  16  7...AEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLYIIYKNKCMRNGPNILIASLALGDLLHIVIAIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGRICLLFYATAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDENSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLNDHLKQRREVAKTVFCLVLVFALCWLPLHLARILKLTLYELLSFLLVLDYIGINMASLNSCANPIALYLVSKRFKNAFKSALCCWAQS. 498
34 -86.6003vg9_A mol:protein length:326 Adenosine receptor A2a  ali model follow..  31  2...............................PIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAIT--ISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKQHDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMES----------------------------------------------------------------------------------------------QPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ 310
35 -86.2003pwh_A mol:protein length:329 Adenosine receptor A2a  ali model follow..  31  2...............................PIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAIT--ISTGFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMES----------------------------------------------------------------------------------------------QPLPGERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ 310
36 -85.7002ydo_A mol:protein length:325 ADENOSINE RECEPTOR A2A  ali model follow..  31  2...............................PIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIA--ISTGFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAHDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMES----------------------------------------------------------------------------------------------QPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ 310
37 -85.1003sn6_R mol:protein length:514 Endolysin,Beta-2 adrenergic receptor  ali model follow..  29  147LAKSRWYNQTPNRAKRVITTFRTGTWDAYAADEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGR----------------------------------------------------------------------------TGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNL--IRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCLRRSSL 496
38 -81.5006d9h_R mol:protein length:389 Chimera protein of Muscarinic acetylcholine receptor M4 and Adenosine receptor A1  ali model follow..  27  29FTPVNGSSGNQSVRLVTSSSLEVLFQGPPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFH--TCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAAKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKV------------------------------------------------------------------------------------------------SASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPS-CHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQ 365
39 -80.5005n2s_A mol:protein length:436 Soluble cytochrome b562,Adenosine receptor A1  ali model follow..  26  82.NEGKVKEAQAAAEQLKTTRNAYIQKYLASSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVLVGALVIPLAILINIGPQTYFH--TCLMVACPVLILAQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAAKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFALIRKQLNKKV------------------------------------------------------------------------------------------------SASSGDPQKYYGKELKIAKSAALIAFLFALSWLPLHILNCITLFCPS-CHKPSILTYIAIFLAHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRSQ 417
40 -79.4005t04_A mol:protein length:513 Neurotensin receptor type 1,Endolysin,Neurotensin receptor type 1  ali model follow..  18  1....DYKDDDDATSTSESDTAGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLARKKSLQSLVHYHLGSLALSDLLILLLAMPVELYNFIWVHWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNRSPGGLVCTPIVDKVVIQVNTFMSFLFPMLVISILNTVIANKLTVMVNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNYNQTPNRAKRVITTFRTGTWDAYGSGSPGRVQALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDE-DFYHYFYMLTNALAYASSAINPILYNLVSANFRQVFLSTLACLCPGW 495
41 -79.1005jqh_A mol:protein length:471 Endolysin,Beta-2 adrenergic receptor  ali model follow..  31  147LAKSRWYNQTPNRAKRVITTFRTGTWDAYAADEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKI------------------------------------------------------------------------------------------------------DIDKFALKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNL--IRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCLRRSSL 470
42 -78.0005zbh_A mol:protein length:527 Neuropeptide Y receptor type 1,T4 Lysozyme,Neuropeptide Y receptor type 1  ali model follow..  16  18....VENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIWSLVLIAVERHQLIINPRGWR--PNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDASHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRS 503
43 -77.7004ntj_A mol:protein length:466 P2Y purinoceptor 12,Soluble cytochrome b562,P2Y purinoceptor 12  ali model follow..  17  2...YKDDDDGAPQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQ-IRSKSNFIIFLKNTVISDLLM-ILTFPFKILSDAKLTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAAEQLKTTRNAYIQKYLRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTAENTLFYVKESTLWLTSLNACLNPFIYFFLCKSFRNSLISMLKCPNSAT 435
44 -77.5005wqc_A mol:protein length:560 Orexin receptor type 2,GlgA glycogen synthase,Orexin receptor type 2  ali model follow..  21  27.ELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFK--STAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLTVCD-IYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQGIDCSFWNESYLTGSRDERKKSLLSKFGMDSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSKQIRARRKTARMLMVVLLVFAICYLPISILNVLKRVFGEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCL.. 548
45 -77.4005nj6_A mol:protein length:437 Proteinase-activated receptor 2,Soluble cytochrome b562,Proteinase-activated receptor 2  ali model follow..  14  2...............VETVFSVDEFSASVLTGKLTTVFLPIVYTIVFVVALPSNGMALWVFLFRTKKKAPAVIYMANLALADLLS-VIWFPLKIAYHIHGNWIYGEALCNVLIGFFYANMYCSILFLTCLSVQRAWEIVNPMGH-SRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFPALQITTCHDVDMFNYFLSLAIGVFLFPAFLTASAYVLMIRALADLEDNWETLNDNLKVIEKADNAAQV-----KDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLENSEKKRKRAIKLAVTVAAMYLICFTPSNLLLVVHYFLIKSQGQSHVLYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRT 413
46 -75.8004xee_A mol:protein length:541 Neurotensin receptor type 1, Endolysin chimera  ali model follow..  18  1....DYKDDDDATSTSESDTAGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLARKKSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNRSADGTHPGGATVKVVIQVNTFMSFLFPMLVISILNTVIANKLTVMVHQAAE-------------------------------------------------------------------------------QGRVCTVGTHNGLEHSTFNMTIEPGRVQALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEFDFYHYFYMLTNALFYASSAINPILYNLVSANFRQVFLSTLACLCPGW 359
47 -75.7002z73_A mol:protein length:448 Rhodopsin  ali model follow..  20  1..MGRDLRDNETWWYNPSIVVHPHWREFDQVPDAVYYSLGIFIGICGIIGCGGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVGFPLMTISCFLKKWIFGFAACKVYGFIGGIFGFMSIMTMAMISIDRYNVIGRPMAASKKMSHRRAFIMIIFVWLWSVLWAIGPIFGWGAYTLEGVLCNCSFSTTRSNILCMFILGFFGPILIIFFCYFNIVMSVSNHEKEMAAMAKRLN-----------------------------------------------------------------------------------------AKELRKAQAGANAEMRLAKISIVIVSQFLLSWSPYAVVALLAQF-GPLEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFREAISQTFPW..... 332
48 -75.5001gzm_A mol:protein length:349 RHODOPSIN  ali model follow..  18  2MNGTEGPNFYVPFSNKTGVVRSPFEAQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFR-FGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGITNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAA-----------------------------------------------------------------------------------------------------QQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGS-DFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPL 329
49 -75.5004ej4_A mol:protein length:461 Delta-type opioid receptor, Lysozyme chimera  ali model follow..  19  14...................................AIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALA-TSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMV-MAVTQPRDGAVVCSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRNIFEMLRIDEGLRLKQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQ 459
50 -75.3006gdg_A mol:protein length:479 TrxA,Adenosine receptor A2a  ali model follow..  29  124LLLFANGEVAATKVGALSKGQLKEFLDANLAEAAAKAVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAIT--ISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAHDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMES----------------------------------------------------------------------------------------------QPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ 463
51 -75.2004dkl_A mol:protein length:464 Mu-type opioid receptor, lysozyme chimera  ali model follow..  18  1...................GSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALA-TSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMF-MATTKYRQGSIDCTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINRTGTWDAYEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTI 461
52 -75.1004zj8_A mol:protein length:553 human OX1R fusion protein to P.abysii glycogen synthase  ali model follow..  19  19MGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFK--STARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELSVCD-LYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGLSRSDLSKFRENCKKRAMSFSKQMRARRKTAKMLMVVLLVFALCYLPISVLNILKRVFGMFRQASDACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPG. 542
53 -75.0003zev_A mol:protein length:338 NEUROTENSIN RECEPTOR 1 TM86V  ali model follow..  19  1.................GPGSGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLARKQSLQSTVDYYLGSLALSDLLILLLAMPVELYNFIWVHWAFGDAGCRGYYFLRDACTYATALNVVSLSVELYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNLSGDGTHPDTATLKVVIQVNTFMSFLFPMLVASILNTVIANKLTVMVHQAA-----------------------------------------------------------------------------------------------EQGRVCTEPGRVQALRRGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEFDFYHYFYMLTNALVYVSAAINPILYNLVSANFRQVFLSTLACLCPGT 330
54 -74.9004bv0_A mol:protein length:338 NEUROTENSIN RECEPTOR TYPE 1  ali model follow..  19  1.................GPGSGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNGVTLFTLARKQSLQSRVDYYLGSLALSDLLILLFALPVDVYNFIWHPWAFGDAGCKGYYFLREACTYATALNVVSLSVELYLAIRHPFKHKTLMSRSRTKKFISAIWLASALLAIPMLFTVGLQNLSGDGTHPGGATLKVVIQLNTFMSFLFPMLVASILNTVIARRLTVMVHQAA-----------------------------------------------------------------------------------------------EQGRVCTEPGRVQALRRGVLVLRAMVIAFVVCWLPYHVRRLMFVYISDEFDFYHYFYMLSNALVYVSAAINPILYNLVSANFRQVFLSTLACLCPGT 330
55 -74.6004buo_A mol:protein length:335 NEUROTENSIN RECEPTOR TYPE 1  ali model follow..  19  2...................GSGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLARKQSLQSTVDYYLGSLALSDLLILLLAMPVELYNFIWVHWAFGDAGCRGYYFLRDACTYATALNVVSLSVELYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNLSGDGTHPGGATLKVVIQVNTFMSFLFPMLVASILNTVIANKLTVMVHQ-------------------------------------------------------------------------------------------------AAFNMTIEPGRVQALRRGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDE-DFYHYFYMLTNALVYVSAAINPILYNLVSANFRQVFLSTLACLCPGT 327
56 -74.4004bwb_A mol:protein length:338 NEUROTENSIN RECEPTOR TYPE 1  ali model follow..  19  1.................GPGSGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNGVTLFTLARKKSLQSRVDYYLGSLALSDLLILLFALPVDLYNFIWHPWAFGDAGCKGYYFLREACTYATALNVVSLSVELYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNLSGDGTHPGGATLRVVIQLNTFMSFLFPMLVASILNTVAARRLTVMVHQ-----------------------------------------------------------------------------------------------AAEQGRVCTEPGRVQALRRGVLVLRAVVIAFVVCWLPYHVRRLMFVYISDE-DFYHYFYMLSNALVYVSAAINPILYNLVSANFRQVFLSTLACLCPGT 330
57 -74.1002ks9_A mol:protein length:364 Substance-P receptor  ali model follow..  20  2.....DNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQ--PRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEI--------------------------------------------------------------------------------------------------PGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLKKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDRFRLGFKHAFRCCPFIS 327
58 -73.9005xjm_A mol:protein length:422 Type-2 angiotensin II receptor,Soluble cytochrome b562,Type-2 angiotensin II receptor  ali model follow..  18  10..................................HLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLL-LATLPLWATYYSYRDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQR-RNPWQASYIVPLVWCMACLSSLPTFYFRDVRTEYLGVNACIMAWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNADLEDNWETLN--DNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWL 410
59 -73.6004djh_A mol:protein length:480 Kappa-type opioid receptor, Lysozyme  ali model follow..  18  1..............GGTTMGSEDAQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALV-TTTMPFQSTVYLMNSWPFGDVLCKIVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVEDVDVIECSLQWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLSGNIFEMLRIDEGLRDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALGSSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRM 474
60 -73.2006GPX Entity 1(prereleased)  ali follow..  19  1......................GAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINYKKLKCLTDIYLLNLAISDLLF-LITLPLWAHS-AANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPNIIFTKCQKEDSVYVCGPYGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRMKKYTCTVCGYIYNPEDGDPDNGVN----------------------------------------------------------PGTDFKDIPDDWVCPLCGVGKDQFEEVEEEKKRHRDVRVIFTIMIVYFLFWTPYNIVILLNTFQEESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGEVLFQ. 349
61 -72.8005zbq_A mol:protein length:525 Neuropeptide Y receptor type 1,T4 Lysozyme  ali model follow..  19  4LFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIWSLVLIAVERHQLIINPRGWR--PNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDASHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNM--------------------------------------------------------------------------------------------------MDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRS 341
62 -72.3004mbs_A mol:protein length:414 Chimera protein of C-C chemokine receptor type 5 and Rubredoxin  ali model follow..  16  1....GAPDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINYKRLKSMTDIYLLNLAISDLFF-LLTVPFWAHY-AAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPNIIFTRSQKEGLHYTCSSHFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRMKKYTCTVCGYIYNPEDGDPDNGVN----------------------------------------------------------PGTDFKDIPDDWVCPLCGVGKDQFEEVEEEKKRHRDVRLIFTIMIVYFLFWAPYNIVLLLNTFQESSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEEFRNYLLVFFQKHIAKR 372
63 -72.1006GPS Entity 1(prereleased)  ali follow..  18  7.RFIRNTQESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINYKKLKCLTDIYLLNLAISDLLF-LITLPLWAHS-AANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPNIIFTKCQKEDSVYVCGPYGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRMKKYTCTVCGYIYNPEDGDPDNGVN----------------------------------------------------------PGTDFKDIPDDWVCPLCGVGKDQFEEVEEEKKRHRDVRVIFTIMIVYFLFWTPYNIVILLNTFQEESTSQLDQATQVTETLGMTHCCINPIIYAFVGEEFRSLFHIALGCRIAPL 377
64 -71.6005ndd_A mol:protein length:619 Lysozyme,Proteinase-activated receptor 2,Soluble cytochrome b562,Proteinase-activated receptor 2  ali model follow..  15  203..................................TTVFLPIVYTIVFVVALPSNGMALWVFLFRTKKKAPAVIYMANLALADLLS-VIWFPLKIAYHIHGNWIYGEALCNVLIGFFYANMYCSILFLTCLSVQRAWEIVNPMGHSR-KKANIAIGISLAIWLLILLVTIPLYVVKQTIFPALQITTCHDVDMFNYFLSLAIGVFLFPAFLTASAYVLMIRALADLEDNWETLNDNLKVIEKADNAAQV-----KDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLENSEKKRKRAIKLAVTVAAMYLICFTPSNLLLVVHYFLIKSQGQSHVLYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRT 595
65 -71.5004xnv_A mol:protein length:421 P2Y purinoceptor 1, Rubredoxin, P2Y purinoceptor 1  ali model follow..  16  18...AGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLY-VLTLPALIFYYFNKDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKMKKYTCTVCGYIYNPEDGDPDNG----------------------------------------------------------VNPGTDFKDIPDDWVCPLCGVGKDQFEEVEEPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARAFNDRVYATYQVTRGLASLNSCVNPILYFLAGDTFRRRLSRATRKASRRS 394
66 -70.9005vbl_B mol:protein length:407 Apelin receptor,Rubredoxin,Apelin receptor Chimera  ali model follow..  17  11FCLVFADYKDDDDKFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASAFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDENTNKVQCEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAMKKYTCTVCGYIYNPEDGDPDNGVN--------------------------------------------------------------PGTDFKDIPDDWVCPLCGVGKDQFEEVEERRRLLSIIVVLVVTFALCKMPYHLVKTLYMLGSDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLLMGQSRL 390
67 -70.3006cmo_R mol:protein length:463 chimera protein of Soluble cytochrome b562 and Rhodopsin  ali model follow..  19  163...............................EPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLQGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFR-FGENHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAA-----------------------------------------------------------------------------------------------------QQQESATTQKAEKEVTRMVIIYVIAFLICWVPYASVAFYIFTHQGS-CFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRNCMLTTICC..... 453
68 -68.7006d26_A mol:protein length:470 Prostaglandin D2 receptor 2, Endolysin chimera  ali model follow..  15  3.....SANATLKPLCPILEQMSRLQSHSATSIRYIDHAAVLLHGLASLLGLVENGVILFVVGC-RMRQTVVTTWVLHLALSDLLA-SASLPFFTYFLAVGSWELGTTFCKLHSSIFFLNMFASGFLLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRIMCYYNVLAALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRADLGLQHRNIFEMLRIDEGGGSGGDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSTTFRTGTWDAYRRRPGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVLPFVTSLAFFNSVANPVLYVLTCPDMLRKLRRSLRTVLESV 451
69 -68.1006dde_R mol:protein length:356 Mu-type opioid receptor  ali model follow..  21  31QSDPCGPNRTGLGENLYFQGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALA-TSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMF-MATTKYRQGSIDCTLTFSNLLKICVFIFAFIMPVLIITVCYGLMILRLKSV------------------------------------------------------------------------------------------------------RMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSST. 355
70 -67.9005zkq_A mol:protein length:438 Platelet-activating factor receptor,Endolysin,Endolysin,Platelet-activating factor receptor  ali model follow..  13  1...................GAPEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKNEIKIFMVNLTMADMLF-LITLPLWIVYYQNQNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRYQAVTRPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGDVTRPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVNIFEMLRIDEGGGSGGDDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYAEVKRRDLWMACTVLAVFIICFVPHHVVQLPWTLAEKFHQAINDAHQVTLCLLSTNCVLNPVIYCFLTKKFRKHLTEKFYSMRSSR 429
71 -67.0005x33_A mol:protein length:523 LTB4 receptor,Lysozyme,LTB4 receptor  ali model follow..  17  4....................DYKDDDDKEFSNTFIPLLAMILLSVSMVVGLPGNTFVVWSILKRMRKRSVTALMVLNLALADLAV-LLTAPFFLHFLTWGTWSFGLAGCRLCHYICGVSMYASVLLITAMSLDRSLAVASPFLSQKVRTKTAARWLLVGIWGASFLLATPVLAFRKVVKLTNETDLCLAVHKAFHLLFEAFTGFVVPFLIVVASYADISRRLRARGSGSNIFEMLRINQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSGSRFHRRRRTGRLVVIIILAFAAFWLPYHVVDLVEGSRVQSKQQLRNARKVCIALAFLSSSVNPLLYACAGGGLLRSAGVGFVAKLLEA 473
72 -66.7006CSY Entity 1(prereleased)  ali follow..  26  133LAKSRWYNQTPNRAKRVITTFRTGTWDAYAADEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKFXLRRSSLKAYGNGYSSNGNTGEQSG..................................................................................................................................................................... 396
73 -64.6002lnl_A mol:protein length:309 C-X-C chemokine receptor type 1  ali model follow..  21  2.................PPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLF-ALTLPIWAASKVNG-WIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKR-HLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHM--------------------------------------------------------------------------------------------------------------GQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVS 308
74 -64.5005o9h_A mol:protein length:317 C5a anaphylatoxin chemotactic receptor 1  ali model follow..  23  8...................................DILALVIFAVVFLVGVLGNALVVW-VTAFEAKRTINAIWFLNLAVADFLA-CLALPALFTSIVQHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFKPAWCQRFRGAGLAWILCAVAWGLALLLTIPSALYRVVREEYFPPKVLCGVDERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSARE--------------------------------------------------------------------------------------------------------------TRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLDSLCVSFAYINCCINPIIYVVAGQGFQGRERKSLPELLREV 293
75 -64.2005xsz_A mol:protein length:477 Lysophosphatidic acid receptor 6a,Endolysin,Lysophosphatidic acid receptor 6a  ali model follow..  16  3..........YNTSLEMEMLNVSNVTHCPKNDNFKYPLYSMVFSIVFMVGLITNVAAMYIFMCSLKLRNETTTYMMNLVVSDLLF-VLTLPLRVFYFVQQNWPFGSLLCKLSVSLFYTNMYGSILFLTCISVDRFLAIVYPFRSRGLRTKRNAKIVCAAVWVLVLSGSLPTGFMLNSTNLENNSISCFENFSSKVVIFIETVGFLIPLMLNVVCSAMVLQTLRRPNTVNIFEMLRIDNGLRLKNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLNKKKILRMIIVHLFIFCFCFIPYNVNLVFYSLVRKGCAAESVVYPIALCIAVSNCCFDPIVYYFTSETIQNSASSEDLYF.... 476

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 8 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.