current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|P11766|ADHX_HUMAN Alcohol dehydrogenase class-3 OS=Homo sapiens GN=ADH5 PE=1 SV=4, from H.sapiens

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370
# Score Template Links and tools%idFirst MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVVKILast
1 -114.0001mc5_A mol:protein length:374 Alcohol dehydrogenase class III chi chain  ali model follow..  100  1MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVVKI 374
2 -111.0001cdo_A mol:protein length:374 ALCOHOL DEHYDROGENASE  ali model follow..  62  3.VGKVIKCKAAVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKDGFPVVLGHEGAGIVESVGPGVTEFQPGEKVIPLFISQCGECRFCQSPKTNQCVKGWANESPDVMSPKETRFTCKGRKVLQFLGTSTFSQYTVVNQIAVAKIDPSAPLDTVCLLGCGVSTGFGAAVNTAKVEPGSTCAVFGLGAVGLAAVMGCHSAGAKRIIAVDLNPDKFEKAKVFGATDFVNPNDHSEPISQVLSKMTNGGVDFSLECVGNVGVMRNALESCLKGWGVSVLVGWTD-LHDVATRPIQLIAGRTWKGSMFGGFKGKDGVPKMVKAYLDKKVKLDEFITHRMPLESVNDAIDLMKHGKCIRTVLSL 374
3 -111.0003uko_A mol:protein length:378 Alcohol dehydrogenase class-3  ali model follow..  68  3.QGQVITCKAAVAYEPNKPLVIEDVQVAPPQAGEVRIKILYTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQAGDHVIPCYQAECRECKFCKSGKTNLCGKVRSATGVGIMMNDKSRFSVNGKPIYHFMGTSTFSQYTVVHDVSVAKIDPTAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKTAGASRIIGIDIDSKKYETAKKFGVNEFVNPKDHDKPIQEVIVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSRTQVPWLVEKYMNKEIKVDEYITHNLTLGEINKAFDLLHEGTCLRCVLDT 376
4 -110.0004rqt_A mol:protein length:375 Alcohol dehydrogenase class-P  ali model follow..  54  1..SQIIRCKAAVAWEAGKPLVIEEVEVAPPQKHEVRIKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPIFTGECGECRHCHSEESNMCDLLRINTERGMIHDGESRFSINGKPIYHFLGTSTFSEYTVVHSGQVAKINPDAPLDKVCIVSCGLSTGLGATLNVAKPKKGQSVAIFGLGAVGLGAAEGARIAGASRIIGVDFNSKRFDQAKEFGVTECVNPKDHDKPIQQVIAEMTDGGVDRSVECTGSVQAMIQAFECVHDGWGVAVLVGVPSKDDAFKTHPMNFLNERTLKGTFFGNYKPKTDIPGVVEKYMNKELELEKFITHTVPFSEINKAFDYMLKGESIRCIITM 373
5 -109.0003cos_A mol:protein length:381 Alcohol dehydrogenase 4  ali model follow..  62  5.KGKVIKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDKISEAFDLMNQGKSIRTILIF 381
6 -108.0004dl9_A mol:protein length:396 Alcohol dehydrogenase class III  ali model follow..  67  15.QGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVKVLYTALCHTDAYTWSGKDPEGLFPCVLGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRAATGVGVMMNDKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPVAPLEKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRIIGIDIDSKKFDRAKNFGVTEFINPKEHEQPIQQVIVDLTDGGVDYSFECIGNVSVMRSALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPSLVDKYLKKEIKVDEYITHNMTLADINKAFDLMHDGDCLRVVLDM 388
7 -108.0001a71_A mol:protein length:374 LIVER ALCOHOL DEHYDROGENASE  ali model follow..  61  3.AGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVT-PLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLWTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTILTF 374
8 -108.0001qlh_A mol:protein length:374 ALCOHOL DEHYDROGENASE  ali model follow..  61  3.AGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVT-PLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVAVTPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTILTF 374
9 -108.0001qv6_A mol:protein length:374 Alcohol dehydrogenase E chain  ali model follow..  61  3.AGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDQVVSGTLVT-PLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDRFAKAKEVGATECVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTILTF 374
10 -107.0001p0c_A mol:protein length:373 NADP-dependent ALCOHOL DEHYDROGENASE  ali model follow..  58  4.AGKDITCKAAVAWEPHKPLSLETITVAPPKAHEVRIKILASGICGSDSSVLKEIIPS-KFPVILGHEAVGVVESIGAGVTCVKPGDKVIPLFVPQCGSCRACKSSNSNFCEKNDMGAKTGLMADMTSRFTCRGKPIYNLMGTSTFTEYTVVADIAVAKIDPKAPLE-SCLIGCGFATGYGAAVNTAKVTPGSTCAVFGLGGVGFSAIVGCKAAGASRIIGVGTHKDKFPKAIELGATECLNPKDYDKPIYEVICEKTNGGVDYAVECAGRIETMMNALQSTYCGSGVTVVLGLASPNERLPLDPLLLLTGRSLKGSVFGGFKGE-EVSRLVDDYMKKKINVNFLVSTKLTLDQINKAFELLSSGQGVRSIMIY 373
11 -107.0001ht0_A mol:protein length:374 CLASS I ALCOHOL DEHYDROGENASE 3, GAMMA SUBUNIT  ali model follow..  62  3.AGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVT-PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGQLDTMMASLLCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNVLPFEKINEGFDLLRSGKSIRTVLTF 374
12 -107.0001hso_A mol:protein length:374 CLASS I ALCOHOL DEHYDROGENASE 1, ALPHA SUBUNIT  ali model follow..  63  3.AGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVT-PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTILMF 374
13 -106.0001ee2_A mol:protein length:373 ALCOHOL DEHYDROGENASE  ali model follow..  63  3.AGKVIKCKAAVLWEQKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVA-PLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFIPQCGKCSVCKHPEGNLCLKNLSMP-RGTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLVGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVAALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGKSIRTILTF 373
14 -106.0001deh_A mol:protein length:374 HUMAN BETA1 ALCOHOL DEHYDROGENASE  ali model follow..  62  3.AGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVT-PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF 374
15 -105.0001agn_A mol:protein length:373 HUMAN SIGMA ALCOHOL DEHYDROGENASE  ali model follow..  60  3.AGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMV-SKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDITG-RGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF 373
16 -105.0001e3e_A mol:protein length:376 ALCOHOL DEHYDROGENASE, CLASS II  ali model follow..  56  3.QGKVIKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKK-ALFPVVLGHECAGIVESVGPGVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLRNFKYQELMEDRTSRFTCKGRSIYHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGAK--VDEMTIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVTHALPFESINDAIDLMKEGKSIRTILTF 376
17 -100.0001f8f_A mol:protein length:371 BENZYL ALCOHOL DEHYDROGENASE  ali model follow..  31  2..SELKDIIAAVTPCKGADFELQALKIRQPQGDEVLVKVVATGMCHTDLIVRDQKYPV-PLPAVLGHEGSGIIEAIGPNVTELQVGDHVVLSY-GYCGKCTQCNTGNPAYCSEFFGRNFSGADSEGNHALCTQGVVNDHFFAQSSFATYALSRENNTVKVTKDVPIELLGPLGCGIQTGAGACINALKVTPASSFVTWGAGAVGLSALLAAKVCGASIIIAVDIVESRLELAKQLGATHVINSKTQD--PVAAIKEITDGGVNFALESTGSPEILKQGVDALGILGK-IAVVGAPQLGTTAQFDVNDLLGGKTILGVVEGSGSPKKFIPELVRLYQQGKFPFDQLVKF-YAFDEINQAAIDSRKGITLKPIIKI 370
18 -99.7005tnx_A mol:protein length:383 Alcohol dehydrogenase zinc-binding domain protein  ali model follow..  32  6.ENDTRAVTAAVARAAGAPFSIEPARIRAPRGDEVLVRVVATGLCHTDLIVRDQYYPV-PLPAVLGHEGAGVVEAVGPNVKTLAAGDHVVLTYGA-CGHCASCAGGHGAYCRQFFALNFGGADADGQTALRDAAPLHDHFFAQSSFASYALARENNAIKVPKEAPLELLGPLGCGIQTGAGAVINSLAVRTGSSFASFGAGAVGMSAVMAARIAGATTIIAVDIVPSRLALALELGATHAINSKEVD--VVDAIREITGGGVDYALESTGLPAVLSQGIDALGSRGT-MGVVGAPKLGTKAEFDVNSLLGGHTIRGIVEGDSVPQTFIPQLVQLHLQGRFPFDRLVKF-YPLEQINQAAADSSSGITLKPILRL 375
19 -78.8005h81_A mol:protein length:389 heteroyohimbine synthase THAS2  ali model follow..  20  16KSAKPVEAYGWAAKDTSGLLSPFKFLRRTTGEHDVQFKVLYCGLCDWDVITTKNTYGTTKYPFVPGHEIMGIVTEIGNKVKKFKVGDKVVGNFIGSCGKCERCNEGLEPYCPK-VIYTDGTAFSDENNTVYGDVSGDGEDRIYGGYSNIMVANEYVVFRWPENLPLAAGVPILCGGIVPYSPMRHFGLDKPGLSIGVVGFGRIGKLAVKFAKAFGANVTVISTSISKKQEAIEKYGVDRFLISKEPEEM------KAAESTLDGIFDCVPSVHPLHPLLNLLKFEGTF-VMLGVAVEAYELPVSPL-LMGRRKFVGSISGT---MKETQEMLDFAAKHNIVSD---IELIPMDYVNTALERIAKGNHKAFVIDI 376
20 -76.4001vj0_A mol:protein length:380 alcohol dehydrogenase, zinc-containing  ali model follow..  24  6.IMMGLKAHAMVLEKFNQPLVYKEFEISDIPRGSILVEILSAGVCGSDVHMFRGEDPRVPLPIILGHEGAGRVVEVNGEKRDLKPGDLIVWNRGITCGECYWCKVSKPYLCPNRKVY---GINRGCSEYPHLRG----------CYSSHIVLPETDVLKVSEKDDLDVLAMAMCSGATAYHAFDEYPESFAGKTVVIQGAGPLGLFGVVIARSLGAENVIVIAGSPNRLKLAEEIGADLTLNRRETSERRKAIMDITHGRGADFILEATGDSRALLEGSELLRRGGFY-SVAGVAVPQDPVPFKVYEWLVLKTFKGIWVSD---TSHFVKTVSITSRNYQLLSKLITHRLPLKEANKALELMESREALKVILY. 371
21 -69.3003two_A mol:protein length:348 Mannitol dehydrogenase  ali model follow..  21  1...MRVQSKGFAIFSKDEHFKPHDFSRHAVGPRDVLIDILYAGICHSDIHSAYSEWKEGIYPMIPGHEIAGIIKEVGKGVKKFKIGDVVVGCFVNSCKACKPCKEHQEQFCT------------KVVFTYDCLDSFHDNEPHMGGYSNNIVVDENYVISVDKNAPLEKVAPLLCAGITTYSP-LKFSKVTKGTKVGVAGFGGLGSMAVKYAVAMGA-EVSVFARNEHKKQDALSMGVKHFYTDPKQC-----------KEELDFIISTIPTHYDLKDYLKLLTYNGDLALVGLPPVEVAPVLSVFDFIHGNRKVYGSLIGG---IKETQEMVDFSIKHNI---YPEIDLILGKDIDTAYHNLTHGKAFRYVIDM 343
22 -69.0004eex_A mol:protein length:348 Alcohol dehydrogenase 1  ali model follow..  25  1.......MKAAVVRHNPGYADLVEKELRAIKPNEALLDMEYCGVCHTDLHVAAGDYGN-KAGTVLGHEGIGIVKEIGADVSSLQVGDRVSVAWFEGCGHCEYCVSGNETFCRE---VKNAGYSVDG------------------GMAEEAIVVADYAVKVPDGLDPIEASSITCAGVTTYKA-IKVSGVKPGDWQVIFGAGGLGNLAIQYAKNVFGAKVIAVDINQDKLNLAKKIGADVIINSGD-VNPVDEIKKITGGLGVQSAIVCAVARIAFEQAVASLKPMGKM-VAVALPNTEMTLSVPTV-VFDGVEVAGSLVGT---RLDLAEAFQFGAEGKV---KPIVATRKLEEINDIIDEMKAGKIERMVIDF 338
23 -68.6001jvb_A mol:protein length:347 NAD(H)-DEPENDENT ALCOHOL DEHYDROGENASE  ali model follow..  27  1.......MRAVRLVEIGKPLSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHMRQGRFGNLKLPVTLGHEIAGKIEEVGDEVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWL---GINFDG------------------AYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAV-RKASLDPTKTLLVVGAGGLGTMAVQIAKAVSGATIIGVDVREEAVEAAKRAGADYVINASM-QDPLAEIRRITESKGVDAVIDLNNSEKTLSVYPKALAKQGKY-VMVGLFGADLHYHAPLI-TLSEIQFVGSLVGN---QSDFLGIMRLAEAGK--VKPMITKTMKLEEANEAIDNLENFKAIGRQVLI 346
24 -68.5002eer_A mol:protein length:347 NAD-dependent alcohol dehydrogenase  ali model follow..  27  1.......MRAMRLVEIGKPLKLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNLKLPVTLGHEIAGRIEEVGDEVVGYSKGDLVAVNPWEGEGNCYYCRIGEEHLCDSPRWL---GINYDG------------------AYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTYRAV-RKASLDPSKTLVVIGAGGLGTMAIQIAKAVSGATIIGVDVREEALEAAKRAGADYVINASS-QDPVSEIRRITQGKGADAVIDLNNSEKTLSIYPYVLAKQGKY-VMVGLFGADLKYHAPLI-TLNEVQFIGSLVGN---QSDFLGIMSLAEAGK--VKPMVTKTMKLEEANEAIDNLENFKAVGRQVLV 346
25 -68.5005o8h_A mol:protein length:352 Alcohol dehydrogenase  ali model follow..  23  1.......MKAVQYTEIGSEPVVVDIPTPTPGPGEILLKVTAAGLCYSDIHVMDMPAAQYGLPLTLGHEGVGTVAELGEGVTGFGVGDAVAVYGPWGCGACHACARGRENYCTRAADL----------------GITPPGLGSPGSMAEYMIVDSARLVPIGDLDPVAAAPLTDAGLTPYHAISRVLPLLGPGSTAVVIGVGGLGHVGIQILRAVSAARVIAVDLDDDRLALAREVGADAAVKSGA--GAADAIRELTGGQGATAVFDFVGAQSTIDTAQQVVAVDGHI-SVVGIHAGAHAKVGFFM-IPFGASVVTPFAGT---RSELMEVVALARAGRL---DIHTETFTLDEGPAAYRRLREGSIRGRGVVV 344
26 -68.5006FG0 Entity 1(prereleased)  ali follow..  24  1.......MKAVQYTEIGSEPVVVDIPTPTPGPGEILLKVTAAGLCHSDITVMDMPAAQGGLPLTLGHEGVGTVAELGEGVTGFGVGDAVAVYGPWGCGACHACARGRENYCTRAADL----------------GITPPGYGSPGSMAEYMIVDSARHLPIGDLDPVAAAPLTDAGLTPYHAISRVLPLLGPGSTAVVIGVGGLGHVGIQILRAVSAARVIAVDLDDDRLALAREVGADAAVKSGA--GAADAIRELTGGQGATAVFDFVGAQSTIDTAQQVVAVDGHI-SVVGIHAGAHAKVGFWM-IPFGASVVTPYWGT---RSELMEVVALARAGRL---DIHTETFTLDEGPAAYRRLREGSIRGRGVVV 344
27 -68.4001kev_A mol:protein length:351 NADP-DEPENDENT ALCOHOL DEHYDROGENASE  ali model follow..  25  1.......MKGFAMLGINK-LGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDG------------------VFGEYFHVNDMNLAILPKDMPLENAVMITDMMTTGFHGA-ELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKN-GHIVDQVMKLTNGKGVDRVIMAGGGSETLSQAVSMVKPGGIISNI-NYHGSGDALLIPRVEGMAHKTIKGGLCPG--GRLRAEMLRDMVVYNRVDLSKLVTHVYHFDHIEEALLLMKPKDLIKAVVIL 351
28 -68.3001jqb_A mol:protein length:351 NADP-dependent Alcohol Dehydrogenase  ali model follow..  25  1.......MKGFAMLGINK-LGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDG------------------VFGEYFHVNDMNLAILPKDMPLENAVMITDMMTTGFHGA-ELADIEMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKN-GHIEDQVMKLTNGKGVDRVIMAGGGSETLSQAVKMVKPGGIISNI-NYHGSGDALLIPRVEGMAHKTIKGGLCPGG--RLRAERLRDMVVYNRVDLSKLVTHVYHFDHIEEALLLMKPKDLIKAVVIL 351
29 -68.2003fpl_A mol:protein length:351 NADP-dependent alcohol dehydrogenase  ali model follow..  25  1.......MKGFAMLGINK-LGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDG------------------VFGEYFHVNDMNLAILPKDMPLENAVMITDMMTTGFHGA-ELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKD-GPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANV-NYFGEGEVLPVPRLEGMAHKTIKGGLCPGG--RLRAEMLRDMVVYNRVDLSKLVTHVYHFDHIEEALLLMKPKDLIKAVVIL 351
30 -68.1005od3_A mol:protein length:352 Alcohol dehydrogenase  ali model follow..  24  1.......MKAVQYTEIGSEPVVVDIPTPTPGPGEILLKVTAAGLCHSDIFVMDMPAAQGGLPLTLGHEGVGTVAELGEGVTGFGVGDAVAVYGPWGCGACHACARGRENYCTRAADL----------------GITPPGYGSPGSMAEYMIVDSARLVPIGDLDPVAAAPLTDAGLTPYHAISRVLPLLGPGSTAVVIGVGGLGHVGIQILRAVSAARVIAVDLDDDRLALAREVGADAAVKSGA--GAADAIRELTGGQGATAVFDFVGAQSTIDTAQQVVAVDGHI-SVVGIHAGAHAKVGFFM-IPFGASVVTPYWGT---RSELMEVVALARAGRL---DIHTETFTLDEGPAAYRRLREGSIRGRGVVV 344
31 -67.3001bxz_A mol:protein length:352 NADP-DEPENDENT ALCOHOL DEHYDROGENASE  ali model follow..  26  1.......MKGFAMLSIGK-VGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDG------------------VFGEFFHVNDMNLAHLPKEIPLEAAVMIPDMMTTGFHGA-ELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKD-GPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANV-NYFGEGEVLPVPRLEGMAHKTIKGGLCPGG--RLRMERLIDLVFYKRVDPSKLVTHVFRFDNIEKAFMLMKDKDLIKPVVIL 351
32 -67.2003fsr_A mol:protein length:352 NADP-dependent alcohol dehydrogenase  ali model follow..  26  1.......MKGFAMLSIGK-VGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDG------------------VFGEFFHVNDMNLAHLPKEIPLEAAVMIPDMMTTGFHGA-ELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKN-GHIVDQVMKLTNGKGVDRVIMAGGGSETLSQAVSMVKPGGIISNI-NYHGSGDALLIPRVEGMAHKTIKGGLCPGG--RLRMERLIDLVFYKRVDPSKLVTHVFRFDNIEKAFMLMKDKDLIKPVVIL 351
33 -66.4004gkv_A mol:protein length:336 Alcohol dehydrogenase, propanol-preferring  ali model follow..  26  1.......MKAAVVTKDH-HVDVTYKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFG-DKTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFEGCGHCEYCNSGNETLCRS---VKNAGYSVDG------------------GMAEECIVVADYAVKVPDGLDSAAASSITCAGVTTYKA-VKLSKIRPGQWIAIYGLGGLGNLALQYAKNVFNAKVIAIDVNDEQLKLATEMGADLAINSHT-EDAAKIVQEKT--GGAHAAVVTAVAKAAFNSAVDAVRAGGRV-VAVGLPPESMSLDIPRL-VLDGIEVVGSLVGT---RQDLTEAFQFAAEGKV---VPKVALRPLADINTIFTEMEEGKIRRMVIDF 334
34 -66.2003wle_A mol:protein length:341 (R)-specific carbonyl reductase  ali model follow..  21  11......SQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLHVIYEGLDC-GDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFG-DWFGLGYDG------------------GYQQYLLVTPRNLSRIPDNVSADVAAASTDAVLTPYHAI-KMAQVSPTSNILLIGAGGLGGNAIQVAKAFGA-KVTVLDKKKEARDQAKKLGADAVYETLP---------ESISPGSFSACFDFVSVQATFDVCQKYVEPKGVI-MPVGLGAPNLSFNLGDL-ALREIRILGSFWGT---TNDLDDVLKLVSEGKV---KPVVRSAKLKELPEYIEKLRNNAYEGRVVF. 339
35 -65.7005h83_A mol:protein length:360 heteroyohimbine synthase HYS  ali model follow..  20  12....PVKTFGFAAKDSSGFFSPFNFSRRATGENDVQFKVLYCGTCNYDLEMSTNKFGMTKYPFVIGHEIVGVVTEIGSKVQKFKVGDKVVGGFVGACEKCEMCVNGVENNCSKVESTDGHFGNNFG------------------GCCNIMVVNEKYAVVWPENLPLHSGVPLLCAGITTYSPLRRYGLDKPGLNIGIAGLGGLGHLAIRFAKAFGAKVTLISSSVKKKREALEKFGVDSFLLNSNPEEMQGA------YGTLDGIIDTMPVAHSIVPFLALLKPLGKL-IILGVPEEPFEVPAPAL-LMGGKLIAGSAAGS---MKETQEMIDFAAKHNI---VADVEVIPIDYLNTAMERIKNSDV-RFVIDV 351
36 -65.7002h6e_A mol:protein length:344 D-arabinose 1-dehydrogenase  ali model follow..  24  1....MVKSKAALLKKFSEPLSIEDVNIPEPQGEEVLIRIGGAGVCRTDLRVWKGVEAKQRLPIILGHENAGTIVEVGE-LAKVKKGDNVVVYATWGDLTCRYCREGKFNICKNQIIP---GQTTNG------------------GFSEYMLVKSSRWLVKLNSLSPVEAAPLADAGTTSMGAIRQAISKFAEPVVIVNGIGGLAVYTIQILKALMKNTIVGISRSKKHRDFALELGADYVSEM---KDAESLINKLTDGLGASIAIDLVGTEETTYNLGKLLAQEGAI-ILVGMEGKRVSLEAFDT-AVWNKKLLGSNYGS---LNDLEDVVRLSESGKI---KPYIIKVPLDDINKAFTNLDEGRVDGRQVI. 342
37 -65.3003fpc_A mol:protein length:352 NADP-dependent alcohol dehydrogenase  ali model follow..  25  1.......MKGFAMLSIGK-VGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDG------------------VFGEFFHVNDMNLAHLPKEIPLEAAVMIPDMMTTGFHGA-ELANIKLGDTVCVIGIGPVGLMSVAGANHLGAGRIFAVGSRKHCCDIALEYGATDIINYKN-GDIVEQILKATDGKGVDKVVIAGGDVHTFAQAVKMIKPGSDIGNV-NYLGEGDNIDIPRGVGMGHKHIHGGL--CPGGRLRMERLIDLVFYKRVDPSKLVTHVFRFDNIEKAFMLMKPKDLIKPVVIL 351
38 -65.2002cf5_A mol:protein length:357 CINNAMYL ALCOHOL DEHYDROGENASE  ali model follow..  21  3IMEAERKTTGWAARDPSGILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYPMVPGHEVVGEVVEVGSDVSKFTVGDIVVGCLVGCCGGCSPCERDLEQYCPK--------------KIWSYNDVYINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGLKQPGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSNKKREEALQDLGADDYVIGSDQAKMSEL------ADSLDYVIDTVPVHHALEPYLSLLKLDGKL-ILMGVINNPLQFLTPLL-MLGRKVITGSFIGS---MKETEEMLEFCKEKGL---SSIIEVVKMDYVNTAFERLEKNDV-RFVVDV 350
39 -65.0001y9a_A mol:protein length:360 NADP-dependent alcohol dehydrogenase  ali model follow..  23  1.......MKGLAMLGIGR-IGWIEKKIPECGPLDALVRPLALAPCTSDTHTVWAGAIGDRHDMILGHEAVGQIVKVGSLVKRLKVGDKVIVPAITPDWGEEESQRGYPMHSGGMLGGWKFSNFKDG------------------VFSEVFHVNEANLALLPRDIKPEDAVMLSDMVTTGFHGA-ELANIKLGDTVCVIGIGPVGLMSVAGANHLGAGRIFAVGSRKHCCDIALEYGATDIINYKN-GDIVEQILKATDGKGVDKVVIAGGDVHTFAQAVKMIKPGSDIGNV-NYLGEGDNIDIPRSEGMGHKHIHGGL--TPGGRVRMEKLASLISTGKLDTSKLITHRFELEKVEDALMLMKNADLIKPVVR. 350
40 -64.6005z0c_A mol:protein length:374 Nerol dehydrogenase  ali model follow..  21  8.EEHTVKAVGWAARDPSGHLSPFTFSRRATGELDVTFKVLYCGICHSDLHYIKNEWSNTIYPALPGHEIVGEVTEVGSKVNKFKVGDKVVGCIVGSCHSCPNCNNHLENYCPN--------------RILTFGSRYYDGTLNHGGYSDLMVVQEHFAVRIPDALPLDSAAPLLCAGITVYSPLRYYGLDKPGLHVGVVGLGGLGHMAVKFAKAFGVKVTVVSTSPAKKEDAISGLGAHSFILSTDAEQM------QAAVGTMDGIIDTVSASHPLPPLISLLKSHGKL-VMVGDPPKPLELPVFPL-LLGRKMVAGSAIGG---MKETQEMIDFAAKEGV---RADVEVIPMDYVNTAMQRVSKSDV-RFVIDI 354
41 -64.4001yqd_A mol:protein length:366 sinapyl alcohol dehydrogenase  ali model follow..  21  14....PVKAFGWAARDQSGHLSPFNFSRRATGEEDVRFKVLYCGVCHSDLHSIKNDWGFSMYPLVPGHEIVGEVTEVGSKVKKVNVGDKVVGCLVGACHSCESCANDLENYCPK--------------MILTYASIYHDGTITYGGYSNHMVANERYIIRFPDNMPLDGGAPLLCAGITVYSPLKYFGLDEPGKHIGIVGLGGLGHVAVKFAKAFGSKVTVISTSPSKKEEALKNFGADSFLVSRDQEQ------MQAAAGTLDGIIDTVSAVHPLLPLFGLLKSHGKL-ILVGAPEKPLELPAFSL-IAGRKIVAGSGIGG---MKETQEMIDFAAKHNI---TADIEVISTDYLNTAMERLAKNDV-RFVIDV 357
42 -64.4001h2b_A mol:protein length:359 ALCOHOL DEHYDROGENASE  ali model follow..  26  15......RLKAARLHEYNKPLRIEDVDYPREGRFDVIVRIAGAGVCHTDLHLVQGMWHELKLPYTLGHENVGYIEEVAEGVEGLEKGDPVILHPAVTDGTCLACRAGEDMHCENLEFP---GLNIDG------------------GFAEFMRTSHRSVIKLPKDISREKLVELADAGITAYRAVKKAATLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDARR--DPVKQVMELTRGRGVNVAMDFVGSQATVDYTPYLLGRMGRLIIV----GYGGELRFPTIRVISEVSFEGSLVGN---YVELHELVTLALQGKV---RVEVDIHKLDEINDVLERLEKGEVLGRAVLI 358
43 -64.0004oh1_A mol:protein length:351 L-iditol 2-dehydrogenase  ali model follow..  24  2MRQLFVTSIRDFEKNTMGTVDMMEAPMPEPKDEEIRIKVVYASICGSDTHILTGNLGESMLPMSFGHELSGVIDKVGSTAEKFKVGQKVVANYAKYCGCCENCREGKVNLCSNMGYRM-------------------------NGFSEYAVYHMSQIFPIPDDADLKDYALLTVALS-----SAEQAKISYGKSVAIMGAGGLGMMLVQLARLAGASTITVFDIVPEKLELALENGADYALNSAEEG--VAERAIELAGGRYDCVLEGTGATAAAKLGLQLLARDGDA-VYFAMYGKDPILPVNLQSDLYWDQK--HIHGMIQGAWQFPKSIRMI--PRMDFSKIIQKEHTLTNYKQAFEDLYSKKYAKIVIK. 348
44 -64.0003gfb_A mol:protein length:350 L-threonine 3-dehydrogenase  ali model follow..  27  4......KMQAIMKTKPAYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNQSRIKPPQIMGHEVAGEVVEVGPGVEDLQVGDYISVETHIVCGKCYACKHNRYHVCQNTKIF---GVDMDG------------------VFAHYAIVPAKNAWKNPKDMPPEYAALQ----PLGNAVDTVLAGPIAGRSTLITGAGPLGLLGIAVAKASGAYPVIVSEPSEFRRKLAKKVGADYVVNPFE-EDPVKFVMDITDGAGVEVFLEFSGAPKALEQGLKAVTPGGRV-SLLGLFPREVTIDFNNLIIFKALEVHGIT--GRHLWETWYTVSSLIQSGKLNLDPIITHKYKFDKFEEAFELMRAGKTGKVVFF. 346
45 -63.8005vkt_A mol:protein length:362 Cinnamyl alcohol dehydrogenases (SbCAD4)  ali model follow..  23  3MEQGCKTAHGWAARDASGHLSPYSFSARIQGDADVTIKVLFCGICHTDLHVIKNEWGNAMYPVVPGHEVVGVVTDVGHGVTKFKAGDTVVGYFVDSCRTCESCSTGHENYCPDLVLT----------------SNGVDGATTKGGFSDVLVVSQDFVVRVPESLPLDGAAPLLCAGVTVYSPMAQYALNEPGKHLGVVGLGGLGHMAVKFAKAFGMTVTVISSSPGKRDEALGRLGADAFLVSHDAAQ------MKAAAATLDGIIDTVSAGHQIVPLLALLKPMGQM-VVVGAPSTPLELPAYAI-ITGGKRVAGNGVGS---VADCQAMLDFAGEHGV---TADIEVVQMDYVNTAIERLEKNDV-RFVIDV 348
46 -63.8005fi3_A mol:protein length:357 Tetrahydroalstonine synthase  ali model follow..  21  11EEVYPVKAFGLAAKDSSGLFSPFNFSRRATGEHDVQLKVLYCGTCQYDREMSKNKFGFTSYPYVLGHEIVGEVTEVGSKVQKFKVGDKVVASIIETCGKCEMCTNEVENYCP----------------------EAGSIDSNYGACSNIAVINENFVIRWPENLPLDSGVPLLCAGITAYSPMKRYGLDKPGKRIGIAGLGGLGHVALRFAKAFGAKVTVISSSLKKKREAFEKFGADSFLVSSNPEEM------QGAAGTLDGIIDTIPGNHSLEPLLALLKPLGKL-IILGAPEMPFEVPAPSL-LMGGKVMAASTAGS---MKEIQEMIEFAAEHNI---VADVEVISIDYVNTAMERLDNSDV-RFVIDI 350
47 -63.4002dq4_A mol:protein length:343 L-threonine 3-dehydrogenase  ali model follow..  23  1.......MRALAKLAPEEGLTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDRGRIRPPLVTGHEFSGVVEAVGPGVRRPQVGDHVSLESHIVCHACPACRTGNYHVCLNTQIL---GVDRDG------------------GFAEYVVVPAENAWVNPKDLPFEVAAIFGNAVH-----TVYAGSGVSGKSVLITGAGPIGLMAAMVVRASGAGPILVSDPNPYRLAFARPYAD-RLVNPLEED--LLEVVRRVTGSGVEVLLEFSGNEAAIHQGLMALIPGGEA-RILGIPSDPIRFDLAGELVMRGITAFGIA--GRRLWQTWMQGTALVYSGRVDLSPLLTHRLPLSRYREAFGLLASGQAVKVILD. 340
48 -63.1001uuf_A mol:protein length:369 ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN YAHK  ali model follow..  23  11.KKAGLKIKAVGAYSAKQPLEPMDITRREPGPNDVKIEIAYCGVCHSDLHQVRSEWAGTVYPCVPGHEIVGRVVAVGDQVEKYAPGDLVVGCIVDSCKHCEECEDGLENYCDHMTGTYNSPTPDEPGHT-------------LGGYSQQIVVHERYVLRIRHPQQLAAVAPLLCAGITTYSP-LRHWQAGPGKKVGVVGIGGLGHMGIKLAHAMGA-HVVAFTTSEAKREAAKALGADEVVNSRNADEM------AAHLKSFDFILNTVAAPHNLDDFTTLLKRDGTM-TLVGAPATPHKSPEVFNLIMKRRAIAGSMIGG---IPETQEMLDFCAEHGI---VADIEMIRADQINEAYERMLRGDV-RFVIDN 358
49 -63.0002d8a_A mol:protein length:348 Probable L-threonine 3-dehydrogenase  ali model follow..  28  4......KMVAIMKTKPGYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNQSRIKPPQIMGHEVAGEVVEIGPGVEGIEVGDYVSVETHIVCGKCYACRRGQYHVCQNTKIF---GVDTDG------------------VFAEYAVVPAQNIWKNPKSIPPEYATLQ-----EPLGNAVDTVLAGSGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFE-EDVVKEVMDITDGNGVDVFLEFSGAPKALEQGLQAVTPAGRV-SLLGLYPGKVTIDFNNLIIFKALTIYGIT--GRHLWETWYTVSRLLQSGKLNLDPIITHKYKFDKYEEAFELMRAGKTGKVVFM. 346
50 -62.6005vm2_A mol:protein length:347 Alcohol dehydrogenase  ali model follow..  25  1.....MKNSKAILQVPGT-MKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKEIGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPNYR-------------------GALTHYLCHPESFTYKLPDNMDTMEGTLV---AAVGMHAA-MLADVKPGKKIIILGAGCIGLMTLQACKCLGATEIAVVDVLEKRLAMAEQLGATVVINGAK-EDTIARCQQFTEDMGADIVFETAGSAVTVKQAPYLVMRGGKI-MIVGTVPGASAINFLKIN---------TIQTVFRYANRYPVTIEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKIIKGVIK. 344
51 -62.6005k1s_A mol:protein length:362 Oxidoreductase, zinc-binding dehydrogenase family  ali model follow..  24  11......HMKAVVLRSFGEALKMETMPMPRPGRGEVLLRVHACGVCYHDVINRRGNLPRTSVPAILGHEAAGEVIEVGPDTPGWKTGDRAATLQRMSCGDCALCRSGRNSLCKTDNRFF--GEELPG------------------GYAQFMVAPVGGLGRVPASLPWNEAATVCCTTGTAVHTVRTRGKVRAGETVLITGAGGVGLSSVQLARLDGA-RVIAVTSSEAKVQALKEAGADEVIVSRG-LDFASDVRKRTQGAGVDVAVEIVG-SATFDQTLKSMAPGGRVVVVGNLESGMVQLNPGLV-IVKELEILGAYATT---QAELDEALRLTATGG--VRQFVTDAVPLAEAAKAHFRLENREVAGRLVL. 351
52 -62.0005yat_A mol:protein length:350 Mitochondrial alcohol dehydrogenase isozyme III  ali model follow..  26  3.PTIPTTQKAVIFETNGGPLEYKDIPVPKPKSNELLINVKYSGVCHTDLHAWKGDWPLDKLPLVGGHEGAGVVVAYGENVTGWEIGDYAIKWLNGSCLNCEYCIQGAESSCAK---ADLSGFTHDG------------------SFQQYATADATQAARIPKEADLAEVAPILCAGITVYKA-LKTADLRIGQWVAISGAGGLGSLAVQYAKALGL-RVLGIDGGADKGEFVKSLGAEVFVDFTKTKDVVAEVQKLTNG-GPHGVINVSVSPHAINQSVQYVRTLGKV-VLVGLPSGAVVNSDVFWHVLKSIEIKGSYVGN---REDSAEAIDLFTRGLV---KAPIKIIGLSELAKVYEQMEAGAIIRYVVDT 348
53 -62.0003meq_A mol:protein length:365 Alcohol dehydrogenase, zinc-containing  ali model follow..  26  14.GSMAKTMKAAVVRAFGKPLTIDEVPIPQPGPGQIQVAIQASGVCHTDLHAAEGDWPVKPPPFIPGHEGVGFVSAVGSGVKHVKEGDRVIPWLYTACGHCRHCLGGWETLCEE---QLNTGYSVNG------------------GFAEYVVADPNFVGHLPKNIDFNEIAPVLCAGVTVYKG-LKVTDTKPGDWVVISGIGGLGHMAVQYARAMGL-NVAAVDIDDRKLDLARRLGATVTVNAKTVADPAAYIRKETDG-GAQGVLVTAVSPKAFEQALGMVARGGTV-SLNGLPPGDFPLSIFNM-VLNGVTVRGSIVGT---RLDLQESLDFAADGKV---KATIQTGKLEDINAIFDDMRQGNIERIVMDL 357
54 -61.0001rjw_A mol:protein length:339 Alcohol dehydrogenase  ali model follow..  30  1.......MKAAVVEQFKEPLKIKEVEKPTISYGEVLVRIKACGVCHTDLHAAHGDWPVKPLPLIPGHEGVGIVEEVGPGVTHLKVGDRVIPWLYSACGHCDYCLSGQETLCEH---QKNAGYSVDG------------------GYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKA-LKVTGAKPGEWVAIYGIGGLGHVAVQYAKAMGL-NVVAVDIGDEKLELAKELGADLVVNPLK-EDAAKFMKEKV--GGVHAAVVTAVSKPAFQSAYNSIRRGGAC-VLVGLPPEEMPIPIFDT-VLNGIKIIGSIVGT---RKDLQEALQFAAEGKV---KTIIEVQPLEKINEVFDRMLKGQINRVVLTL 336
55 -60.8005kia_A mol:protein length:351 L-threonine 3-dehydrogenase  ali model follow..  24  1.....MAMKALAKLERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDQKTIPVPMHVGHEYVGEIVEMGQEVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGV---GVNREG------------------AFAEYLAIPAFNAFKIPPEISDDLAAIF-----DPFGNATHTALSFVGEDVLITGAGPIGVMAVAIAKHVGARNVVITDINDYRLDLARRMGATRAVNVSR-ESLRDVMADLHMTEGFDVGLEMSGVPSAFTSLLESMNHGGKV-ALLGIPPAQTAIDWNQV-IFKGLEIKGIY--GREMFETWYKMVAMLQSG-LDLSPIITHRFAVDDYEKGFAAMLSGESGKVILD. 341
56 -60.3004w6z_A mol:protein length:347 Alcohol dehydrogenase 1  ali model follow..  24  3....PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPKLPLVGGHEGAGVVVGMGENVKGWKIGDYAIKWLNGSCMACEYCELGNESNCPH---ADLSGYTHDG------------------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKA-LKSANLMAGHWVAISGAGGLGSLAVQYAKAMGY-RVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDG-GAHGVINVSVSEAAIEASTRYVRANGTT-VLVGMPAGAKCCSDVFNQVVKSISIVGSYVGN---RADTREALDFFARGLV---KSPIKVVGLSTLPEIYEKMEKGQIVRYVVDT 345
57 -60.2004z6k_A mol:protein length:346 Alcohol dehydrogenase  ali model follow..  29  1.......MKAAVLHEFGQSLQIEEVDIPTPGAGEIVVKMQASGVCHTDLHAVEGDWPVKPPPFIPGHEGVGLITAVGEGVTHVKEGDRVGVAWLSACGHCTHCLGGWETLCES---QQNSGYSVNG------------------SFAEYVLANANYVGIIPESVDSIEIAPVLCAGVTVYKG-LKMTDTKPGDWVVISGIGGLGHMAVQYAIAMGL-NVAAVDIDDDKLAFAKKLGAKVTVNAKN-TDPAEYLQKEI--GGAHGALVTAVSAKAFDQALSMLRRGGTL-VCNGLPPGDFPVSIFDT-VLNGITIRGSIVGT---RLDLQESLDMAAAGKV---KATVTAEPLENINDIFERMRQGKIERIVIDY 336
58 -60.1003s1l_A mol:protein length:340 Zinc-containing alcohol dehydrogenase superfamily  ali model follow..  27  2......MMKAAVVRAFGAPLTIDEVPVPQPGPGQVQVKIEASGVCHTDLHAADGDWPVKPLPFIPGHEGVGYVSAVGSGVSRVKEGDRVVPWLYSACGYCEHCLQGWETLCEK---QQNTGYSVNG------------------GYGEYVVADPNYVGLLPDKVGFVEIAPILCAGVTVYKG-LKVTDTRPGQWVVISGIGGLGHVAVQYARAMGL-RVAAVDIDDAKLNLARRLGAEVAVNARD-TDPAAWLQKEI--GGAHGVLVTAVSPKAFSQAIGMVRRGGTI-ALNGLPPGDFGTPIFDV-VLKGITIRGSIVGT---RSDLQESLDFAAHGDV---KATVSTAKLDDVNDVFGRLREGKVERVVLDF 338
59 -60.0001llu_A mol:protein length:342 Alcohol Dehydrogenase  ali model follow..  27  6......TMKAAVVHAYGAPLRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWPVPPLPFIPGHEGVGYVAAVGSGVTRVKEGDRVIPWLYTACGCCEHCLTGWETLCES---QQNTGYSVNG------------------GYAEYVLADPNYVGILPKNVEFAEIAPILCAGVTVYKG-LKQTNARPGQWVAISGIGGLGHVAVQYARAMGL-HVAAIDIDDAKLELARKLGASLTVNARQ-EDPVEAIQRDI--GGAHGVLVTAVSNSAFGQAIGMARRGGTI-ALVGLPPGDFPTPIFDV-VLKGLHIAGSIVGT---RADLQEALDFAGEGLV---KATIHPGKLDDINQILDQMRAGQIERIVLEM 342
60 -59.3006c49_A mol:protein length:350 Alcohol dehydrogenase  ali model follow..  21  1MAMSNNTIQAYAAMQAGEKLVPYKFDAGELQPHQVEVKVEYCGLCHSDISVLNNEWHSTVYPVVAGHEIIGRIVALGSEAKGLQIGQRVIGWTAESCQACDECIGGQQVLCT--------------------GENIATIVGHAGGFADKVRAGWQWAIPLPEDLDPESAGPLLCGGITVFDP-LLKHKIQATHHVGVIGIGGLGHIAIKLLKAWGC-EITAFSSNPDKTEELKAMGADHVVNSRDTEAVKAQ------KGKFDLLLSTVNVTLNWRAFISTLAPNGSL-HFLGLTLEPVPVSVGSL-IDGAKSVTGSPTGS---PAALRQLLKFAARKKI---APQIELFPMSQLNEAIERLHSGQA-RIVLKA 340
61 -59.1004cpd_A mol:protein length:347 ALCOHOL DEHYDROGENASE  ali model follow..  25  1.......MRAVVFENKER-VAVKEVNAPRQHPLDALVRVHLAGICGSDLHLYHGKIPVLP-GSVLGHEFVGQVEAVGEGIQDLQPGDWVVGPFHIACGTCPYCRRHQYNLCERGGVY----------------GYGPMFGNLQGAQAEILRVPNVNLRKLPPNLSPERAIFAGDILSTAYGGL-IQGQLRPGDSVAVIGAGPVGLMAIEVAQVLGASKILAIDRIPERLERAASLGAIPI--NAEQENPVRRVRSETNDEGPDLVLEAVGGAATLSLALEMVRPGGRVSAVGVDNAPSFPFPLASG-LVKDLTFRI---GLANVHLYIDAVLALLASGRLQPERIVSHYLPLEEAPRGYELFDRKEALKVLLV. 344
62 -58.0004ej6_A mol:protein length:370 Putative zinc-binding dehydrogenase  ali model follow..  25  17......MMKAVRLESVGN-ISVRNVGIPEPGPDDLLVKVEACGICGTDRHLLHGEFPSTP-PVTLGHEFCGIVVEAGSAVRDIAPGARITGDPNISCGRCPQCQAGRVNLCRNLRAI---GIHRDG------------------GFAEYVLVPRKQAFEIPLTLDPVHGAFLACCLH-----GVDLSGIKAGSTVAILGGGVIGLLTVQLARLAGATTVILSTRQATKRRLAEEVGATATVDPSA-GDVVEAIAGPVGPGGVDVVIECAGVAETVKQSTRLAKAGGTV-VILGVLPQGEKVEIEPFDILFREL---RVLGSFINPFVHRRAADLVATGAIEIDRMISRRISLDEAPDVISNPAAAGEVKVLVI. 355
63 -57.9004a2c_A mol:protein length:346 GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE  ali model follow..  22  1.......MKSVVNDTDGI-VRVAESVIPEKHQDEVRVKIASSGLCGSDLPRIFKN-GAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFI---GSRRDG------------------GFAEYIVVKRKNVFALPTDMPIEDGAFITVGLH-----AFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSE-MSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQL-ALVGTLHQDLHLTSATFGKILRKTVIGSWYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLL. 344
64 -56.8004ilk_A mol:protein length:359 Starvation sensing protein rspB  ali model follow..  21  8LVPRGSHMKSILIEKPNQ-LSIIEREIPTPSAGEVRVKVKLAGICGSDSHIYRGHNPFAKYPRVIGHEFFGVIDAVGEGVESARVGERVAVDPVVSCGHCYPCSIGKPNVCTTLAVL---GVHADG------------------GFSEYAVVPAKNAWKIPEAVADQYAVMI---FTIAANVT-GHGQPTENDTVLVYGAGPIGLTIVQVLKVYNVKNVIVADRIDERLEKAKESGADWAINNSQTP---LGESFAEKGIKPTLIIDAACHPSILKEAVTLASPAARIVLM---GFSSEPSEVIQQGITGKEL---SIFSSRLNANKFPVVIDWLSKGLIKPEKLITHTFDFQHVADAISLFELKHCCKVLLTF 351
65 -56.8003qe3_A mol:protein length:355 Sorbitol dehydrogenase  ali model follow..  22  1.AKPAAENLSLVVHGPGD-LRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGDFVVKKPMVLGHEASGTVVKVGSLVRHLQPGDRVAIQPGAPRQTDEFCKIGRYNLSPTIFFCATPPD---------------------GNLCRFYKHNANFCYKLPDNVTFEEGALLSVGI------ACRRAGVTLGNKVLVCGAGPIGLVNLLAAKAMGAAQVVVTDLSASRLSKAKEVGADFILEISNESEEIAKKVEGLLGSKPEVTIECTGVETSIQAGIYATHSGGTL-VLVGLGSEMTSVPLVHAATRE------DIKGVFRYCNTWPMAISMLASKSVNVKPLVTHRFPLEKALEAFETSKKGLGLKVMIK. 347
66 -56.4004oaq_A mol:protein length:367 R-specific carbonyl reductase  ali model follow..  18  3.KAVPDKFQGFAVSDPKNWPKLASYERKQINPHDVVLKNEVCGLCYSDIHTLSAGWQLQRDNLVVGHEIIGEVIAVGDEVTEFKVGDRVIGAASSSCRSCQRCDSDNEQYCK------------QGAATYNSKDVRSNNYVTQGGYSSHSIADEKFVFAIPEDLPSSYGAPLMCAGITVFSPLIRNGLDARGKNVGIIGIGGLGHLALQFANAMGA-NVTAFSRSSSKKEQAMKLGAHDFVATGEDKTWYKNY---DDHFDFILNCASGIDGLNLSEYLSTLKVDKKF-VSVGLPPSEDKFEVSPFTFLQGASFGSSLLGS---KTEVKEMLNLAAKHNV---RPMIEEVPISEENKALDRCHAGDV-RFVFTD 361
67 -56.3006dkh_A mol:protein length:346 L-idonate 5-dehydrogenase (NAD(P)(+))  ali model follow..  19  1.SNAMQVKTQSCVVAGKKTVAVTEQTI-DWNNNGTLVQITRGGICGSDLHYYQEGNFMIKAPMVLGHEVIGKV--IHSDSSELHEGQTVAINPSKPCGHCKYCIEHNENQCTDMRFFGSAMYFPHVD----------------GGFTRYKMVETSQCVPYPAKADEKVMAFA---LAVAIHAA-HQAGELQGKRVFISGVGPIGCLIVSAVKTLGAAEIVCADVSPRSLSLGKEMGADVLVNPQNDD----MDHWKAEKGYFDVSFEVSGHPSSVNTCLEVTRARGVM-VQVGMGGAMAEFPMMTLIGKE------SLRGSFRFTSEFNTAVSWLANGVINPLPLLSAEYPFTDLEEALRFAGDTQAAKVQLVF 346
68 -56.2001pl6_A mol:protein length:356 Sorbitol dehydrogenase  ali model follow..  21  1.AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPD---------------------GNLCRFYKHNAAFCYKLPDNVTFEEGALLSVGI------ACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTL-VLVGLGSEMTTVPLLHAAIRE------DIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLK. 348
69 -54.3003ip1_A mol:protein length:404 Alcohol dehydrogenase, zinc-containing  ali model follow..  21  30......TWLGSKVWRYPE-VRVEEVPEPREKPTEIIIKVKACGICGSDVHMAQTDEGLTGFPVTLGHEFSGVVVEAGPEAIRFEIGEPVCAEEMLWCGHCRPCAEGFPNHCENLNEL---GFNVDG------------------AFAEYVKVDAKYAWSLREDRLFLAGSLVEPTSVAYNAVIVRGGGIRPGDNVVILGGGPIGLAAVAILKHAGASKVILSEPSEVRRNLAKELGADHVIDPTK-ENFVEAVLDYTNGLGAKLFLEATGVPQLVWPQIEEVIWRARNATVAIVARADAKIPLTGEVFQVRRQIVGSQ--GHSGHGTFPRVISLMASG-MDMTKIISKTVSMEEIPEYIKRLQTDKSLVKVTM. 394
70 -54.2003m6i_A mol:protein length:363 L-arabinitol 4-dehydrogenase  ali model follow..  19  3.SSASKTNIGVFTNPQHASPSLESVQKGELKEGEVTVAVRSTGICGSDVHFWKHG-MIVECDHVLGHESAGEVIAVHPSVKSIKVGDRVAIEPQVICNACEPCLTGRYNGCERVDFLSTPPV---------------------GLLRRYVNHPAVWCHKIG-NMSYENGAML---LSVALAGL-QRAGVRLGDPVLICGAGPIGLITMLCAKAAGACPLVITDIDEGRLKFAKEICPEVVTHKVEAEESAKKIVESFGGIEPAVALECTGVESSIAAAIWAVKFGGKV-FVIGVGKNEIQIPFMRASVRE------DLQFQYRYCNTWPRAIRLVENGLVDLTRLVTHRFPLEDALKAFETASDPKAIKVQIQ. 360
71 -54.2004jlw_A mol:protein length:399 Glutathione-independent formaldehyde dehydrogenase  ali model follow..  20  1.....MSGNRGVVYLGPGKVEVQNIPYGRQIDHGVILRVVSTNICGSDQHMVRGRTTAPE-GLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCLTVNPARAGGAYGYVDMG--------------GGQAEYVLVPDFNLLKLPNREAAMELTCLSDILPTGYHGA-VTAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIVGDVNPTRLAHAKKQGFEIADLSKD-TPLHEQIAALLGEPEVDCAVDAVGFETVLNSLMGITRVAGKIGIP-GLYVTEDPGAVDAAAKHGALSIHSFHTGQTPVMKYNRQLMQAIMWDRIKIADIVVEVITLDDAPKGYGEFDAGVPKKFVID. 391
72 -54.1002dph_A mol:protein length:398 Formaldehyde dismutase  ali model follow..  17  2......GNKSVVYHGTRD-LRVETVPYPKLEHNNVILKVVSTNICGSDQHIYRGRFIVPK-GHVLGHEITGEVVEKGSDVELMDIGDLVSVPFNVACGRCRNCKEARSDVCENNLVNPDADLGAFGFDLKGWSG----------GQAEYVLVPYADLLKFGDKEQAMELTLISDILPTGFHGC-VSAGVKPGSHVYIAGAGPVGRCAAAGARLLGAACVIVGDQNPERLKLLSDAGFETIDLRNS-APLRDQIDQILGKPEVDCGVDAVGPNGALNSLFDVVRAGGAIGIPVNKDAGSGRLHLDFGKMWKSIRIMT---GMAPVTNYNRHLTEAILWDQMPYKVMNIEVITLDQAPDGYAKFDKGSPAKFVID. 390
73 -53.5001kol_A mol:protein length:398 formaldehyde dehydrogenase  ali model follow..  21  2......GNRGVVYLGSGK-VEVQKIDYGKKIEHGVILKVVSTNICGSDQHMVRGRTTAQV-GLVLGHEITGEVIEKGRDVENLQIGDLVSVPFNVACGRCRSCKEMHTGVCLTVNPARAGGAYGYVDM---------------GGQAEYVLVPDFNLLKLPDRDKAMELTCLSDILPTGYHGA-VTAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVVIVGDLNPARLAHAKAQGFEIADLSLD-TPLHEQIAALLGEPEVDCAVDAVGPATVLNSLMQVTRVAGKIGIP-GLYVTEDPGAVDAAAKIGSLSIHSFHTGQTPVMKYNRALMQAIMWDRINIAEVVVQVISLDDAPRGYGEFDAGVPKKFVID. 390
74 -53.0002b5v_A mol:protein length:357 glucose dehydrogenase  ali model follow..  18  1.......MKAIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGFPEGEDHLVLGHEAVGVV--VDPNDTELEEGDIVVPTVRRASGTNEYFERDQPDMAPDGMYFERGIVGAHG------------------YMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKAAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYDRPDPTIDIIEELDATYVDSRQTPVEDVPDVY-----EQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHVLHNKALVGSV--NSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFD--DDDTTIKTAIEF 354
75 -52.2004jbg_A mol:protein length:370 Alcohol dehydrogenase (Zinc)  ali model follow..  22  28.SGGGHEMRAAAFSTPGENLKLVEAETPRPGPGEVLIRVKYAGVNPLDYNVVAGAVKASPMPHIPGSEFAGVVEEAGPGVTGVSRGDPVVVYNRLYCGHCRQCLTGWTQMCEV-TGGGIIGIVTQG------------------GYAEYAVVPAKNAVATRAD--LKEAATLPIGALTAWNM-AYRASISPGEKVAVVGAGNVGIYAVQFAKLLGGEVYAISRRKAKVESILKSAGADAVLTPDE----------AKSAAPFDVVLDPTG-SASWDLSFGVLGRGGRYVTAGALTGAEVRLDLRRL-YGMQILVIGATGGR---RADFNTVVRLLEAGRIK--AFLHNVYPLADVRKALEELRSPERVGKVLI. 362

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 8 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.