current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q9H013|ADA19_HUMAN(removed signalp:1-25) Disintegrin and metalloproteinase domain-containing protein 19 OS=Homo sapiens GN=ADAM19 PE=1 SV=3 (Range: 301-600), from H.sapiens

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst GGVNMDHSENAIGVAATMAHEMGHNFGMTHDSADCCSASAADGGCIMAAATGHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGGRRCGNGYLEDGEECDCGEEEECNNPCCNASNCTLRPGAECAHGSCCHQCKLLAPGTLCREQARQCDLPEFCTGKSPHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDMNGEHRKCNMRDAKCGKIQCQSSEARPLESNAVPIDTTIIMNGRQIQCRGTHVYRGPEEEGDMLDPGLLast
1 -81.0002dw0_A mol:protein length:419 Catrocollastatin  ali model follow..  40  124TGIIQDYSEINLVVAVIMAHEMGHNLGINHDSGY---CSCGDYACIMRPEISPEPSTFFSNCSYFECWDFIMNHNPECILNEPLGTDIISPPVCGNELLEVGEECDCGTPENCQNECCDAATCKLKSGSQCGHGDCCEQCKFSKSGTECRASMSECDPAEHCTGQSSECPADVFHKNGQPCLDNYGYCYNGNCPIMYHQCYDLFGADVYEAEDSCFE-RNQKGNYYGYCRKE-NGNKIPCAPEDVKCGRLYCKDNSPGQ......................................... 377
2 -80.9003g5c_A mol:protein length:510 ADAM 22  ali model follow..  35  123GGVNEFGKTDL--MAVTLAQSLAHNIGIISDKRKLAS-CEDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNSGGGACLFNKPS--KLLDPPECGNGFIETGEECDCGTPAECLEGAECCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKD-KDTWIQCNKRDVLCGYLLCTNIGNIPRLGELDGEITLVVQQGRTLNCSGGHVKLEEDVDLGYVEDG. 422
3 -80.5003hdb_A mol:protein length:417 AAHIV  ali model follow..  38  122VGIIQDYSPINLVLAVIMAHEMGHNLGIHHDDGYCYCG---GYPCIMGPSISPEPSKFFSNCSYIQCWDFIMNHNPECIDNEPLGTDIISPPLCGNELLEVGEECDCGTPENCQNPCCDAATCKLKSGSQCGHGKCCEQCKFRTSGTECRASMSECDPAEHCTGQSSECPADVFHKNGEPCLDNYGYCYNGNCPIMYHQCYALFGADIYEAEDSCFE-SNKKGNYYGYCRKE-NGKKIPCASEDVKCGRLYCKDDSPGQ......................................... 375
4 -80.3002e3x_A mol:protein length:427 Coagulation factor X-activating enzyme heavy chain  ali model follow..  38  126VGIVQEQGNRNFKTAVIMAHELSHNLGMYHDGKN---CICNDSSCVMSPVLSDQPSKLFSNCSIHDYQRYLTRYKPKCIFNPPLRKDIVSPPVCGNEIWEEGEECDCGSPANCQNPCCDAATCKLKPGAECGNGLCCYQCKIKTAGTVCRRARDECDVPEHCTGQSAECPRDQLQQNGKPCQNNRGYCYNGDCPIMRNQCISLFGSRANVAKDSCFQ-ENLKGSYYGYCRKE-NGRKIPCAPQDVKCGRLFCLNNSPRN--------------------KNPCNMHYSCMDQHGMVDPG. 400
5 -79.5003dsl_A mol:protein length:419 Zinc metalloproteinase-disintegrin bothropasin  ali model follow..  37  124VAIVEDYSPINLVVAVIMAHEMGHNLGIHHDTDF---CSCGDYPCIMGPTISNEPSKFFSNCSYIQCWDFIMKENPQCILNEPLGTDIVSPPVCGNELLEVGEECDCGTPENCQNECCDAATCKLKSGSQCGHGDCCEQCKFSKSGTECRASMSECDPAEHCTGQSSECPADVFHKNGQPCLDNYGYCYNGNCPIMYHQCYALFGADVYEAEDSCFK-DNQKGNYYGYCRKE-NGKKIPCAPEDVKCGRLYCKDNSPGQ--------------------NNPCKMFYSNDDEHGMVLPG. 398
6 -78.8003k7l_A mol:protein length:422 Atragin  ali model follow..  36  131AAVVQDYSSRTRMVAITMAHEMGHNLGMNHDRGFCTCG----FNKCVMSTRRTKPAYQFSSCSVREHQRYLLRDRPQCILNKPLSTDIVSPPICGNYFVEVGEECDCGSPADCQSACCNATTCKLQHEAQCDSEECCEKCKFKGARAECRAAKDDCDLPELCTGQSAECPTDVFQRNGLPCQNNQGYCYNGKCPIMTNQCIALRGPGVKVSRDSCFT-LNQRTRGCGLCRME-YGRKIPCAAKDVKCGRLFCKRRNSMICNCSISPRDPNYGMVEPGTKC.................... 404
7 -78.1002ero_A mol:protein length:427 vascular apoptosis-inducing protein 1  ali model follow..  37  133AGIVQDHSKIHHLVAIAMAHEMGHNLGMDHDKDT---CTCGTRPCVMAGALSCEASFLFSDCSQKDHREFLIKNMPQCILKKPLKTDVVSPAVCGNYFVEVGEECDCGSPRTCRDPCCDATTCKLRQGAQCAEGLCCDQCRFKGAGTECRAAKDECDMADVCTGRSAECTDRFQRNGQ-PCKNNNGYCYNGKCPIMADQCIALFGPGATVSQDACFQ-FNREGNHYGYCRKE-QNTKIACEPQDVKCGRLYCFPNSPEN--------------------KNPCNIYYSPNDEDGMVLPG. 406
8 -69.1003k7n_A mol:protein length:397 K-like  ali model follow..  33  126VAIVQDYNRRISLVASTITHELGHNLGIHHDKASCICI----PGPCIMLKKRTAPAFQFSSCSIREYREYLLRDRPQCILNKPLSTDIVSPPICGNYFVEVGEECDCGSPQACQSACC-----------------NAATCQFKGAETECRVAKDDCDLPELCTGQSAECPTDSLQRNGHPCQNNQSYCYNGTCPTLTNQCITLLGPHFTVSPKGCFN-LNMRGDDGSFCRME-DGTKIPCAAKDVKCGRLYCTEKNTMSCLIPPNPDGIMAEPGGDGMVC.................... 385
9 -57.5006be6_A mol:protein length:449 Disintegrin and metalloproteinase domain-containing protein 10  ali model follow..  25  151TVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGKENGNYIMYARATSLNNNKFSLCSIRQISQVLEKKRNNCFVESGQ-------PICGNGMVEQGEECDCGYSDQCKDECCEGRKCKLKPGKQCSPSQCTAQCAFKSKSEKCRDD-SDCAREGICNGFTALCPASDPKPQFTDCNRHTQVCINGQCAGSECTCASSDGKDDKELCHVCCMKKMDPSTCASTGSVQWS-RHFSGRTITLQPGS-PCNDFR............................................ 423
10 -44.6005l0q_A mol:protein length:203 Disintegrin and metalloproteinase domain-containing protein 10  ali model follow..  23  2....................................................................................VGLASGQPICGNGMVEQGEECDCGYSDQCKDECCEGKKCKLKPGKQCSPSQCTAHCAFKSKTEKCRDD-SDCAKEGICNGITALCPASDPKPNFTDCNRHTQVCINGQCEKHGLEECTCASSDGKDDKELCH-VCCMKKMEPSTCASTGSNKYFLGRTITLQPGS-PCNDFR............................................ 187
11 -40.5002mop_1 mol:protein length:83 Disintegrin bitistatin  ali model follow..  46  1.........................................................................................SPPVCGNKILEQGEDCDCGSPANCQDRCCNAATCKLTPGSQCNYGECCDQCRFKKAGTVCRIARGDWN-DDYCTGKSSDCPWN................................................................................................................................ 82
12 -35.3002i47_A mol:protein length:288 ADAM 17  ali model follow..  25  177..KNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECADQGGKYVMYPIADHENNKMFSQCSKQSIYKTIESKAQECFQERSN-------KVCGNSRVDEGEECDPGS............................................................................................................................................................................................... 282
13 -33.5001l3x_A mol:protein length:73 platelet aggregation inhibitor disintegrin  ali model follow..  50  1...................................................................................................EAGEECDCGSPGNP---CCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRA-RGDDLDDYCNGISAGCPRNPFH............................................................................................................................. 72
14 -33.4002m7f_A mol:protein length:79 Zinc metalloproteinase/disintegrin  ali model follow..  45  1...................................................................................................EFGKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDWN-DDRCTGQSADCPRNGLY............................................................................................................................. 72
15 -33.3002m7h_A mol:protein length:79 Zinc metalloproteinase/disintegrin  ali model follow..  45  1...................................................................................................EFGKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDWN-DDRCTGQSADCPRNPWN............................................................................................................................. 72
16 -33.1003uci_A mol:protein length:72 disintegrin  ali model follow..  50  2..................................................................................................AEFGKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIA-RLDDLDDRCTGQSADCPRY................................................................................................................................ 71
17 -32.6001r54_A mol:protein length:214 ADAM 33  ali model follow..  61  123GGVSTDHSELPIGAAATMAHEIGHSLGLSHDPDGCCVAAAESGGCVMAAATGHPFPRVFSACSRRQLRAFFRKGGGACLSNAPS........................................................................................................................................................................................................................ 207
18 -31.9001fvl_A mol:protein length:70 FLAVORIDIN  ali model follow..  45  1.....................................................................................................GEECDCGSPSNP---CCDAATCKLRPGAQCADGLCCDQCRFKKKRTICRIARG-DFPDDRCTGLSNDCPRWNDL............................................................................................................................. 70
19 -31.8001dth_A mol:protein length:203 ATROLYSIN C  ali model follow..  32  124IGIVQDHSPINLLMGVTMAHELGHNLGMEHDGKD---CLRGASLCIMRPGLTKGRSYEFSDDSMHYYERFLKQYKPQCILNKP......................................................................................................................................................................................................................... 203
20 -31.8001nd1_A mol:protein length:202 BaP1  ali model follow..  38  123VGVVRDHSKNNLWVAVTMAHELGHNLGIDHDTGS---CSCGAKSCIMASVLSKVLSYEFSDCSQNQYETYLTNHNPQCILNKP......................................................................................................................................................................................................................... 202
21 -31.8001kuf_A mol:protein length:203 metalloproteinase  ali model follow..  37  125VAVVKDHSSKVFMVAVTMTHELGHNLGMEHDDKDKCKC----DTCIMSAVISDKQSKLFSDCSKDYYQTFLTNDNPQCILNAP......................................................................................................................................................................................................................... 203
22 -31.8003gbo_A mol:protein length:200 Zinc metalloproteinase BmooMPalfa-I  ali model follow..  38  121VGVVMDHSPKNLQVAVTMAHELGHNLGMHHDGNQ---CHCDAASCIMADSLSQVLSYEFSDCSQNQYQTYLTKHNPQCILNEP......................................................................................................................................................................................................................... 200
23 -31.8002m75_A mol:protein length:76 Zinc metalloproteinase/disintegrin  ali model follow..  46  1...................................................................................................EFGKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDWN-DDRCTGQSADCPRY................................................................................................................................ 69
24 -31.7004q1l_A mol:protein length:202 Snake venom metalloproteinase leucurolysin-A  ali model follow..  37  123VAVVMDHSKKNLRVAVTMAHELGHNLGMRHDGNQ---CHCNAPSCIMADTLSKGLSFEFSDCSQNQYQTYLTKHNPQCILNKP......................................................................................................................................................................................................................... 202
25 -31.7001iag_A mol:protein length:202 ADAMALYSIN II  ali model follow..  33  123VGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKD---CLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP......................................................................................................................................................................................................................... 202
26 -31.6002aig_P mol:protein length:202 ADAMALYSIN II  ali model follow..  33  123VGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKD---CLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP......................................................................................................................................................................................................................... 202
27 -31.5001wni_A mol:protein length:201 Trimerelysin II  ali model follow..  36  123VGLVQDYSPNVFMVAVTMTHELGHNLGMEHDDKDKCKC----EACIMSDVISDKPSKLFSDCSKNDYQTFLTKYNPQCILNAP......................................................................................................................................................................................................................... 201
28 -31.3004j4m_A mol:protein length:202 zinc-dependent metalloproteinase  ali model follow..  39  124VGLVQDHSSNVFMVAVTMTHELGHNLGMAHDEAGGCAC----SSCIMSPAASSGPSKLFSDCSKDDYQTFLTNTNPQCILNAP......................................................................................................................................................................................................................... 202
29 -31.3004dd8_A mol:protein length:208 Disintegrin and metalloproteinase domain-containing protein 8  ali model follow..  46  120GAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLS...................................................................................................................................................................................................................... 208
30 -31.3001yp1_A mol:protein length:202 FII  ali model follow..  33  122AGIIQDFSAIPLLMAVVMAHELGHNLGMLHDDGYSCDC----DVCIMAPSLSSDPTKVFSNCSLILYEDFLSNEEPDCIDNASNN....................................................................................................................................................................................................................... 202
31 -31.2001j2l_A mol:protein length:70 Disintegrin triflavin  ali model follow..  45  1.....................................................................................................GEECDCGSPSNP---CCDAATCKLRPGAQCADGLCCDQCRFKKKRTICRIARG-DFPDDRCTGQSADCPRWNGL............................................................................................................................. 70
32 -30.7004m4c_A mol:protein length:68 Zinc metalloproteinase/disintegrin  ali model follow..  47  1.....................................................................................................GKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIA-RGDPPDDRCTGQSADCPRY................................................................................................................................ 67
33 -30.6001q7j_A mol:protein length:68 Hemorrhagic protein-rhodostomin  ali model follow..  46  1.....................................................................................................GKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIAKGDWN-DDRCTGQSADCPRY................................................................................................................................ 67
34 -30.6004r5u_A mol:protein length:68 Disintegrin rhodostomin  ali model follow..  46  1.....................................................................................................GKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICEIP-RGDMPDDRCTGQSADCPRY................................................................................................................................ 67
35 -30.5002pjg_A mol:protein length:68 Rhodostoxin-disintegrin rhodostomin  ali model follow..  46  1.....................................................................................................GKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRG-EMPDDRCTGQSADCPRY................................................................................................................................ 67
36 -30.5001n4y_A mol:protein length:68 KISTRIN  ali model follow..  46  1.....................................................................................................GKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRG-DMPDDRCTGQSADCPRY................................................................................................................................ 67
37 -30.5002pji_A mol:protein length:68 Rhodostoxin-disintegrin rhodostomin  ali model follow..  46  1.....................................................................................................GKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARG-DMPDDRCTGQSADCPRY................................................................................................................................ 67
38 -30.4002ljv_A mol:protein length:68 Disintegrin rhodostomin  ali model follow..  47  1.....................................................................................................GKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIP-RLDMPDDRCTGQSADCPRY................................................................................................................................ 67
39 -30.1001bsw_A mol:protein length:197 PROTEIN (ACUTOLYSIN A)  ali model follow..  34  120VGVIQDHSSVNRLVAITLAHEMAHNLGVSHDEGS---CSCGGKSCIMSPSISDETIKYFSDCSYIQCRDYIAKENPPCILN........................................................................................................................................................................................................................... 197
40 -29.7004r5r_A mol:protein length:68 Disintegrin rhodostomin  ali model follow..  46  1.....................................................................................................GKECDCSSPENP---CCDAATCKLRPGAQCGEGLCCEQCKFKKKRTICRIPRGDMP-DDRCTGQSADCPRY................................................................................................................................ 67
41 -29.4001qua_A mol:protein length:197 ACUTOLYSIN-C  ali model follow..  39  122VGLIQDHSAIPLLMAVTMAHELGHNLGMNHDGAGCSC-----ATCIMAPVLSSGPAKSFSDCSKHDYQSFLTIHKPQCLLN........................................................................................................................................................................................................................... 197
42 -29.2001z1x_A mol:protein length:64 disintegrin  ali model follow..  37  1...............................................................................................................NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRA-MLDGLHDYCTGVTSDCPRNRYNH............................................................................................................................ 64
43 -29.0001tej_A mol:protein length:64 disintegrin chain A  ali model follow..  37  1...............................................................................................................NSVNPCCDPVICKPRDGEHCISGPCCNNCKFLNSGTICQRARGDGN-HDYCTGITTDCPRNRYNV............................................................................................................................ 64
44 -28.9003c05_B mol:protein length:64 Disintegrin acostatin-beta  ali model follow..  45  1..............................................................................................................DAPANPCCDAATCKLTTGSQCADGLCCDQCKFMKEGTVCRRA-RGDDLDDYCNGISAGCPRNPFH............................................................................................................................. 64
45 -28.9001tej_B mol:protein length:64 disintegrin chain B  ali model follow..  35  1...............................................................................................................NSVNPCCDPQTCKPIEGKHCISGPCCENCYFLRSGTICQRARGDGN-NDYCTGITPDCPRNRYNV............................................................................................................................ 64
46 -28.8001rmr_A mol:protein length:64 Disintegrin schistatin  ali model follow..  35  1...............................................................................................................NSVHPCCDPVICEPREGEHCISGPCCENCYFLNSGTICKRARGDGN-QDYCTGITPDCPRNRYNV............................................................................................................................ 64
47 -28.1003c05_A mol:protein length:62 Disintegrin acostatin alpha  ali model follow..  43  1...............................................................................................................EPKNPCCDAATCKLTPGSQCAEGLCCDQCKFIKAGKICRRARG-DNPDYRCTGQSGDCPRKHF.............................................................................................................................. 62
48 -26.3002rjq_A mol:protein length:378 ADAMTS-5  ali model follow..  19  141...........LHAAFTVAHEIGHLLGLSHDDSKFCE-STEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQTY--DATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQCLTKKLPAVEGTPCGKGRICLQGKCVDKTKKKYYSTSSHGNWGSWGSWG--------------QCSRSCGGGVQFAYRHCNNPAPRNNGRYGKRAIYRSCSLMPCPPNGKSFGSAWSHPQFEK.......................................... 378
49 -25.3002a8h_A mol:protein length:271 ADAM 17  ali model follow..  19  173.TKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECADQGGKYVMYPIAVSENNKMFSQCSKQSIYKTIESKAQECFQERS--------NKVGS............................................................................................................................................................................................................ 265
50 -24.4002oi0_A mol:protein length:266 TNF- a Converting Enzyme (TACE)  ali model follow..  18  173..KNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECADQGGKYVMYPIAVSENNKMFSQCSKQSIYKTIESKAQECFQERSN-------KVIEGR........................................................................................................................................................................................................... 266
51 -22.7004wk7_A mol:protein length:235 A disintegrin and metalloproteinase with thrombospondin motifs 4  ali model follow..  25  134.AIVEDDG---LQSAFTAAHELGHVFNMLHDNSKPCISLLSTSRHVMAPVMAHDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPVTFPD............................................................................................................................................................................................................. 228
52 -22.7002jih_A mol:protein length:300 ADAMTS-1  ali model follow..  26  137.......EDDGLQAAFTTAHELGHVFNMPHDDAKQCA-GVNQDSHMMASMLSNDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGTSY-DANRQC---------------------------------QFTFGEDSKHCPDAASTCS---WCSGGVLVCQTKHFWADGTSCGEGK-WCINGKCVNKLVP..................................................................................................... 299
53 -22.5002ech_A mol:protein length:50 ECHISTATIN  ali model follow..  40  1.................................................................................................................................ECESGPCCRNCKFLKEGTICKRA-RGDDMDDYCNGKTCDCPRNPHKGPATX........................................................................................................................ 50
54 -22.2003hy7_A mol:protein length:221 A disintegrin and metalloproteinase with thrombospondin motifs 5  ali model follow..  25  136.AVIEDDG---LHAAFTVAHEIGHLLGLSHDDSKFCEETSTEDKRLMSSILTSDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQ...................................................................................................................................................................................................................... 220
55 -19.5002w9o_A mol:protein length:46 SHORT DISINTEGRIN JERDOSTATIN  ali model follow..  37  1...............................................................................................................................AMDCTTGPCCRQCKLKPAGTTCWRT---SVSSHYCTGRSCECPSYPGN............................................................................................................................. 45
56 -18.7002w9u_A mol:protein length:46 SHORT DISINTEGRIN JERDOSTATIN  ali model follow..  37  1...............................................................................................................................AMDCTTGPCCRQCKLKPAGTTCWKTSVSSH---YCTGRSCECPSYPGN............................................................................................................................. 45
57 -18.0002rjp_A mol:protein length:316 ADAMTS-4  ali model follow..  22  137.......EDDGLQSAFTAAHQLGHVFNMLHDNSKPCISPLSTSRHVMAPVMAHDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPVTFPGKDY-DADRQC---------------------------------QLTFGPDSRHCPQLPPPCA---WCSGHLNG-TKHSPWADGTPCGPAQ-ACMGGRCLHMDQLQDF-QADYKDDDDK....................................................................................... 316
58 -15.9001mpz_A mol:protein length:41 Obtustatin  ali model follow..  45  1..................................................................................................................................CTTGPCCRQCKLKPAGTTCWKTSLTSH---YCTGKSCDCPLYP............................................................................................................................... 40
59 -11.3003p24_A mol:protein length:397 BFT-3  ali model follow..  17  329DFKASGMSTTQLMYPGVMAHELGHILGANHADD---------PKDLMYSKYT-GYLFHLSEKNMDIIAKNLGWEIAD............................................................................................................................................................................................................................... 395
60 -11.1004hx3_A mol:protein length:134 Extracellular small neutral protease  ali model follow..  21  65GYIFLDYQQN-YDSTRVTAHETGHVLGLPDHYQGPC-------SELMSGGGPGPSCTNPNAQERSRVNALWANG.................................................................................................................................................................................................................................. 134
61 -10.9003m0c_C mol:protein length:791 Low-density lipoprotein receptor  ali model follow..  17  11.............................................................................................LLLAAAGTAVGDRCERNEQCQDGKCISYKWVCDGSAECQDGSTCLSVTCKSGDFSCGGRVNRCPQFWRCDGQVD-CDSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASC--PVLTCGPASFQCNSS------TCIPQLWACNDPDCEDGSD........................................... 175
62 -10.1004l63_A mol:protein length:266 ECXA  ali model follow..  15  154.............LRITIKHEIGHILGLLHNNEGGSYFPHGVGLEVARCRLLNQAPSIMLNGSNYDYIDRLSHYLER............................................................................................................................................................................................................................... 217
63 -10.1004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  18  185............................................IVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECI--------------CPPGF--MGRTCECELGRTCKERCSGQEGCKSYVFCLPDPYGC--SCATGWKGLQC----------------NEACHPGFY---GPDCKL-RCSCNNGEMCDRFQGCLCSPGWQGLQCEREG..................................................................................... 322
64 -9.6705mw5_A mol:protein length:293 Protein jagged-2  ali model follow..  22  171............................................................................................RCDENYY--SATCN--KFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECR-----CSYGW---QGRFCDEPYPGCVHGSCVE-PWQCNCETNWGGL----LCDKDLNGS.............................................................................. 285
65 -9.1705mw7_A mol:protein length:332 Protein jagged-2  ali model follow..  20  171............................................................................................RCDENYYSA----TCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECR-----CSYGW---QGRFCDEPYPGCVHGSCEPWQCNCETNWGLLCDKDLNYCGSHHPCTNG--GTCINAEPDQY-RCTCPDGYSGR-NCE............................................... 319

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.