current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q9H013|ADA19_HUMAN(removed signalp:1-25) Disintegrin and metalloproteinase domain-containing protein 19 OS=Homo sapiens GN=ADAM19 PE=1 SV=3 (Range: 751-930), from H.sapiens

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst VINTPEILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPIPPAPNCIVSQDFSRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAALAPKVSPREALKVKAGTRGLQGGRCRVEKTKQFMLLVVWTELPEQKPRAKHSCFLVPALast
1 -25.5003jcm_A mol:protein length:2413 Pre-mRNA-splicing factor 8  ali model follow..  1MSGLPPPPPGFEEDSDLAPPPPPPPPGYEIEELDNPMVPSSVNEDTFLPPPPPPPSNFEINAEEIVDFTLPPPPPPPGLDELETKAEKKVELHGKRKLDIGKDTFVTRKSRKRAKKMTKKAKRSNLYTPKAEMPPEHLRKIINTHSDMASKMYNTDKKAFLGALKYLPHAILKLLENMPH 181
2 -19.8005ife_C mol:protein length:1304 Splicing factor 3B subunit 1  ali model follow..  11  256..PTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGTPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPL 438
3 -16.6004hsi_A mol:protein length:703 Envelope glycoprotein B  ali model follow..  14  1.....................................DPAAPTSPGTPGVAAATQAANGGPATPAPPPLGAAPTGDPKPKKNKKPKNPTPPRPAGDNATVAAGHATLREHLRDIKAENTDANFYVCPPPTGATVVQFEQPRRCPTRPEGQNYTE.......................... 117
4 -14.5005i4d_A mol:protein length:343 Superantigen-like protein  ali model follow..  3........................SSENLYFQGEKIQSTKVDKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTDMTPKYED....... 151
5 -14.4005fur_J mol:protein length:677 TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 6  ali model follow..  496.APQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQ 674
6 -13.9005izt_A mol:protein length:396 Outer surface protein  ali model follow..  6..EDYKNKVKGILNKAADDQETTSADTNSNAAKNIPIADNDKVAAELKKQSQAAKTVAAAPNKGSQNQPQTTPNKGSQNQQAAPSPQLQSLSFSADLSNLPKTTAARAASLTKQRIPIQAVTTVPGNTRTFNSRNSGLPTFALNYSFSQPTRQQTNSSSAVQTTTSSGSKLQT....... 176
7 -13.9005yfp_H mol:protein length:753 Exocyst complex component EXO84  ali model follow..  8......KARNNWKHVKKSASSPAKQKTPPSPAKPKQKTKKNPYSDLKDPATSYTLPTINARERSRVATSMQRRLSIHNTNYAPPTLDYSMPLPDMPNMIVPNDNVDSSHNNSSFTTENESVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNPSGSNDPFNNSTSLRKMLANPH 181
8 -13.1004jjn_K mol:protein length:382 Regulatory protein SIR3  ali model follow..  212......SVPVSGQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRGTSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSEEIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNPEVSDDGGLEEETDEVS... 382
9 -13.0003j3i_A mol:protein length:982 Capsid protein  ali model follow..  10  555.ECDFNPTMNLKAAGPKARLRGSGVKSRRRVSEVPLAHVFRSPPRRESTTTTDDSPRWLTREGPQLTRRVPIIDEPPAYESGRSSSPVTSSISEGTSQHEEEMGLFDAEELPMQQTVIATEARRRLGRGTLERIQEAALEGQVAQGEVTAEKNRRIEAMLSARDPQFTGREQITKMLSDG 733
10 -13.0003gdb_A mol:protein length:937 Putative uncharacterized protein spr0440  ali model follow..  8LENLYFQGEETAVPENSGANTELVSGESEHSTNEADKQNEGEHARENKLEKAEGVATASETASPASNEAATTETAEAASAAKPEEKASEVVAETPSAEAKPKSDKETEAKPEATNQGDESKPAAEANKTEKEVQPDVPKNTEKTLKPKEIK............................. 158
11 -13.0001i3q_A mol:protein length:1733 DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT  ali model follow..  13 1544.PTSPTYSPTSPAYSPTSPSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSSPTSPAYSPTSPSSPTSPSYSPTSPSYSPTSPSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENE 1730
12 -12.5005fur_I mol:protein length:1199 TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 2  ali model follow..  1011...PESVAGNQEAANNPSSHPQLVGFQNPFSSSQDEEEIDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPASSRSALIPQHSAGCDSTPTTKPQWSLELARKGTGKEQAPLEMSMHPAASAPLSVFTKESTASKHSDEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSSPS 1189
13 -12.4005x4z_A mol:protein length:1743 DNA-directed RNA polymerase subunit  ali model follow..  10 1563.TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPASPQYSPSRHSPNGESKE 1741
14 -12.4005lzs_b mol:protein length:245 Uncharacterized protein,eL29  ali model follow..  131............................................................PQIKGKVKAQIKAQAQAQIKSKGKGKAQAETKPKAQAETKPKAQAQAKPKA----QAQGKPKAQAQGKPKAQAQAKPKAQAQAKPKAQAQTKPKAQATPAAPVPAQAPPKGAQPPAKAP. 245
15 -12.3004rco_A mol:protein length:295 Putative uncharacterized protein  ali model follow..  1MGSSENLYFQGTTLSSTKVEAPQSTPPSTKIEAPQSKPNATTPPSTKVEAPQQTANATTPPSTKVTTPPSTNTPQPMQSTKSDTPQSPTTKQVPTEINPK................................................................................ 100
16 -12.2003h0g_A mol:protein length:1752 DNA-directed RNA polymerase II subunit rpb1  ali model follow..  11 1572...MPSSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPPTSPSYSPTSPSYSPTSPS 1752
17 -11.8005oik_Z mol:protein length:1087 Transcription elongation factor SPT5  ali model follow..  785.PMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGY 963
18 -11.6005z56_u mol:protein length:793 Splicing factor 3A subunit 1  ali model follow..  10  537...PEDDTKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVP. 712
19 -11.4005udb_B mol:protein length:620 Origin recognition complex subunit 2  ali model follow..  11  8.VEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKAPRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNHDFTSPL 190
20 -11.3005n5y_P mol:protein length:894 RNA polymerase I-specific transcription initiation factor RRN6  ali model follow..  776................................DMDDINEEDESNEFNFDSQFSAPFNGRPPFNLNSQSQIPTIKSSQSSGLARRKRILKTQSQKATPLSQSTQNLSVLPDSMTPAFTLMQPPSSQISFVNDSQPRNSQKAKKKKKR.................................. 889
21 -11.1005a9q_4 mol:protein length:925 NUCLEAR PORE COMPLEX PROTEIN NUP107  ali model follow..  2.....DRSGFGEISSPVIREAEVTRTARKQSAQKRVLLQASQDENFGNTTPRNQVIPRTPSSFRQPFTPTSRSLLRQPDISCILGTGGKSPRLTQSSGFFGNLSMVTNLDDSNWAAAFSSQRSGLFTNTEPHSITEDVTISAVMLREDDPGEAAS......................... 151
22 -11.1006ez8_A mol:protein length:3138 Huntingtin  ali model follow..  499.HTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPL 677
23 -11.1006gmh_M mol:protein length:1726 Transcription elongation factor SPT6,Transcription elongation factor SPT6,Transcription elongation factor SPT6  ali model follow..  1537.NATPANINLADLTRAVNALPQNMTSQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIESTPDATP. 1719
24 -11.1004ady_A mol:protein length:963 26S PROTEASOME REGULATORY SUBUNIT RPN2  ali model follow..  790..............PRMYEEASGKEVEKVATAVLSTTARAKARAKKTKKEKGPNEEEKKKEHEEKEKERETNKKGIKETKENDEEFYKNKYSSKPYKVDNMTRILPQQSRYISFIKDDRFVPVRKFKGNN-RDREPKEPVALIETVRQMKDVNAPLPTPFKVDDNVDFPSALQP...... 953
25 -10.8005x5v_A mol:protein length:402 GD  ali model follow..  13  226.QQPPHREVVNYWYRKNGRTLPRAYAAATPYAIDPARPSAGSPRPRPRPRPRPRPKPEPAPATPAPPDRLPEPATRDHAAGGRPTPRPPRPETPHRPFAPPAVVPSGWPQPAEPFQPRTPAAPGVSRHRSVIVGTGTAMGALLVGVCVYIFFRL---RGAKGYRLLGGPADADELKAQPG 401
26 -10.7005zz8_t mol:protein length:3122 UL36  ali model follow..  13  295.VQTPRADRPPEAPRGASGPPDTPQAGHPNRPPDDVWAAALEGTPPAKPSAPDAAASGPPHAAPPPQTPAGDAAEEAEDLRVLEVGAVPVGRHRARYSTGLPKRRRPTWTPPSSVEDLTSGERPAPKAPPAKAKKKSAPKKKAPVAAEVPASSPTPIAATVPPAPDTPPQSGQGGGDDGP 473
27 -10.6005uie_H mol:protein length:330 Vacuolar protein sorting-associated protein VTA1  ali model follow..  12  166.......................IGSSDEKTLDYADFADDSEEIKDEDVDHQTSDLENNNNDKVEGLAPKDQTTSYEPVDEVPEFIDDADSVNEEEQTVDKNEDAITKDEQQVVKKEVDLTRPSAPSEPAAAEHKSYTKDELTKIMDRASKIEQIQ........................ 298
28 -10.4005udb_F mol:protein length:435 Origin recognition complex subunit 6  ali model follow..  104..........NSSPMKQFAWTPSPKKNKRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFVIPELPPMQTNESPSITRRKLAFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRSGRTKQNKAVGKPQSELKTAKALRKRGRIPNSLL 273
29 -10.3005lzs_M mol:protein length:218 Uncharacterized protein  ali model follow..  12  115............................AKKMRNRIIKNEVKKLQRAALLKASPKKAPVAKGAVAAAAAAAKVPAKKATAAGKKAAAQKAPAQKAPAQKAAGQKAAQPPKAQKGQKPPAQKAPAPKASGKKA................................................ 218
30 -10.1006d4h_A mol:protein length:1455 Protein patched homolog 1  ali model follow..  1234LSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRRDAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVAVHPPPVPGPGRNPRGGLCPGYPETDHGLFEDP. 1412
31 -9.8406cgr_n mol:protein length:3139 Large tegument protein deneddylase  ali model follow..  10  305.SETSRGTAGPSAKPEAKRPNRAPDDVWAVALKGTPPTDPPSADPPSADPPSAIPPPPPSAPKTPAAEAAEEDDDDMRVLEMGVVPVGRHRARYSAGLPKRRRPTWTPPSSVEDLTSGEKTKRSAPPAKTKKKSTPKGKTPVGAAVPASVPEPVLASAPPDPAGPPVAEAGEDDGPTVPA 483
32 -9.8304wse_A mol:protein length:584 Putative poly(A) polymerase catalytic subunit  ali model follow..  444.................................SFTRMNRLRLLEKRKQGKQTSFVYTPEDFFKKDLETQAKLDPSKARFKNTSGNKIMVPKYLLFKIDNNGNIEDNIHSEEAEISEKEETSGGSSISTDKSFEESPNSSPNSSPNNSLNNSIDISTNNYDDRSENSLDSLTSD...... 584
33 -9.8003j7o_M mol:protein length:213 Ribosomal protein eL14  ali model follow..  10  124.................KLEVKKLQKAALLKASPKKALAKGAAAAAAAAAAKVPVKKITTAGKKAPAQKAPAQKAAGQKAAPPPKAQKVQKPPA-QKAPAPKASGEKA........................................................................ 213
34 -9.5706gml_A mol:protein length:1973 DNA-directed RNA polymerase subunit  ali model follow..  12 1790.....SPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPPTYSLTSPAISPDDSD 1970
35 -9.3504d5y_M mol:protein length:215 60S RIBOSOMAL PROTEIN EL14  ali model follow..  11  128....................................KKLQKAALLKASPKKAPGTKGTAAAAAAAAAAKVPAKKITAASKKAPAQKVPAQKATGQKAAPAPKAQKGQKAPAQKAPAPKASGKKA........................................................ 215
36 -9.3301m2v_B mol:protein length:926 protein transport protein SEC24  ali model follow..  1MSHHKKRVYPQAQLQYGQNATPLQQPAQFMPPQDPAAAGMSYGQMGMPPQGAVPSMGQQQFLTPAQEQLHQQIDQATTSMNDMHLHNVPLVDPNAYMQPQVPVQMGTPLQQQQQPMAAPAYGQPSAAMGQNMRPMNQLYPIDLLTELPPPITDLTLPPPPLVIPPERMLVPSELSNASPD 180
37 -9.3003jcs_Q mol:protein length:245 ribosomal protein L19e  ali model follow..  156...................AEQLAAKHLRDEQNRNKARKQELRKREKERERARRDDAAAAAQKKKADAAKKSAASAAKSAAPAAKSAAPAAKVAAPATKGAAPVKKSK........................................................................ 244
38 -9.1905gjv_A mol:protein length:1873 Voltage-dependent L-type calcium channel subunit alpha-1S  ali model follow..  1607..QVDTFLERTNSLPPVMANQRPLQFAEIEMEELESPVFLEDFPQDARTNPLARANTNNANANVAYGNSNHSNNQMFSSVHCEREFPGEAETPAAGRGALSHSHRALGPHSKPCAGKLNGQLVQPGMPINQAPPAPCQQPSTDPPERGQRRTSLTGSLQDEAPQRRSSEGSTPRRPAPAT 1784

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 8 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.