current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q9H013|ADA19_HUMAN(removed signalp:1-25) Disintegrin and metalloproteinase domain-containing protein 19 OS=Homo sapiens GN=ADAM19 PE=1 SV=3 (Range: 751-930), from H.sapiens

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst VINTPEILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPIPPAPNCIVSQDFSRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAALAPKVSPREALKVKAGTRGLQGGRCRVEKTKQFMLLVVWTELPEQKPRAKHSCFLVPALast
1 -20.300PF11725.8; Q887C9_PSESM/17-1794; AvrE-family Type-III effector proteins (T3Es)  ali follow..  12  35.LKSVGKLFQKSKAPQQKAATPPTAKNVKTPPPASNVATPRNKARESGFSNSSPQNTHSAPKSILRNHPNQASSSGAQTHEIHPEAAPRKNLRVRFDLPQDRLERSPSYLDSDNPMTDEEAVANATRQFRSPDSHLQGSDGTRISMLATDPDQPSSSGSKIGDSDGPIPPREPMLWRSNG 213
2 -19.700PF05934.11; CLCC1_RAT/3-541; Mid-1-related chloride channel (MCLC)  ali follow..  11  364........PEREPPRALEPDDRRRQKELDYRFHGGAGDADFSYRGPAGSIEQGPYDKMHVCERDVLRQRQVNMRFPSGNKSPEVLRAFDLPDTEAQEHPEVVPSHKPSIVNTSLKETSELPRESTLAECSQCAKDGSGQVPSTAESSPIVEKAQLKTDSECRPHSTEAAAAAARPVSSPC 538
3 -18.500PF05518.11; CAPSD_HV19S/10-772; Totivirus coat protein  ali follow..  578....TVGRPIGIAPGRSNAGDNQARRARTRASVELSAASRRARVFGRPDVGEMPTLTSAPAPIPASPAYDGNRGGEAGGVTGRGNNRSAAPGHASWSERQADGVPVNVTPHHNALRAPPFPRQQGALGGGGNVPLPPAPGAAPPPPPGPPNGPPAGPPPSDDGSSNPAAPVPTAIHAPPA 753
4 -14.700PF15324.6; H9GLI0_ANOCA/127-1404; Hedgehog signalling target  ali follow..  15  965.TVVPSAAALLPEKETLLPTPLATPEATPPQSPPPALNEQFPVKTPTSSPSVTEMDGEQPQTGPEAAAASVVYTPVATPVATPPKIATPTPPVSERAPNREAMEKPPPPNPWEDAELPLEEEKPSPQSEEGAYPSRAVIMSVAKHEEPDSLVLPASVPIAPQDLQSQEPRARSPSVQSPS 1143
5 -14.300PF05460.13; Q75D89_ASHGO/10-395; Origin recognition complex subunit 6 (ORC6)  ali follow..  12  96......................TSSPVRNLNLSPSPKKDGGRLSARDPVELRAELFGTPVKRAGAVTLPGAGELSPTKQLSPSKPMSPVKPSPRRRLAFEDEDEDYEPDASPQPSPRRSIFPGGFEPDPDESEFDSPTKSPFKSPTRSPTKSAQSSPRKKRGEYNQWNMLYKKYYRITPE 253
6 -14.000PF07218.11; Q8ILZ1_PLAF7/1-782; Rhoptry-associated protein 1 (RAP-1)  ali follow..  65..SSESFLENKSSVDDGNINLTDTSTSNKSSKKGHGRSRVRSASAAAILEEDDSKDDMEFKASPSVVKTSTPSGTQTSGLKSSSPSSTKSSSPSNVKSASPHGESNSSEESTTKSSKRSASVAGIVGADEEAPPAPKNTLTPLEELYPTNVNLFNYKYSLNNMEENINILKNEGDLVAQK 242
7 -13.900PF15623.6; F7G021_CALJA/1-281; Cancer/testis gene family 47  ali follow..  10  149........PHPVMPSSDEPPLLVSERLGAGARAPESDDLGLIEEAEVVPEPEVPANLVEMAREPEEEPAEEAAEGKPSGEEPAEEAVPKAATEEPASAEEPATQEAAAPEEVTKYQYEKWDEEVQGAAGEEEKEQGKEKDA....................................... 281
8 -13.500PF07267.11; Q2NNY4_NPVHC/1-628; Nucleopolyhedrovirus capsid protein P87  ali follow..  220.AAHESVDDVRNFAKAVWRANNAPDYTEQTPMPEQSWQSPQQTPAYTEQTPMPEQSWQSPQQTPAYTEQTPMPEQSWQSPQQTPAYTEQTPMPEQGWQSPQQTPNLQPMQTPNPVYEWEEKLREMFPSDLSLQSQKESSSSNGSTVGGFTRRRRRRAPPLPELSSEEEEDPPKNVNQQMY 398
9 -13.400PF09786.9; B9HQ86_POPTR/12-670; Cytochrome B561, N terminal  ali follow..  10  90ISLYRVKIAGVRITSPSKDARDQPQLTNRQLGLIGVKPKVEPVVSESSKKPPKSNPTSSASNVLVPIHQLITCSHQKSRVGSDKSNAGSGNKMASFSTPSKSRNSPSFYLVPGANSPLPSVQSSPAIDSAVSTPWSDKRASYTKEIRTEEQLEQFLAEVDEKISESAGKYATPPPTIG.. 267
10 -12.700PF03276.14; GAG_SFVCP/9-622; Spumavirus gag protein  ali follow..  10  163LRRQLAERSSIGQGGISPGASHSRPPVSSFSGLPSLPAIPGIHTRAPSPPRATSTPGNIPRSLGDDNMPSSSFAGPSQPRVSFHPGNPFAEAEGHRPRSQSRERRRDIPSAPVISAPVPSAPPMIQYIPVPPPPPVGAVIPIQHIRSVTGEPPRNPREIPIWLGRNAPAIDGVFPTTTPD 342
11 -12.700PF05609.12; G1QDE7_MYOLU/26-480; Lamina-associated polypeptide 1C (LAP1C)  ali follow..  11.SQAQETTVTASTTKEAQILSPASGLNKDHQEVETIGSGSADTSNQSESPDEASYGNYPKDKTELKTNQSFQDGKLGHQLSSKKSGGEESLHPEPSCCPSEEVGRADAQLGSSSVDLPEEASNRPEASQKPLAVDPQGVRGPDHSSAGPESQGTRRRRLVEPGEGSHQQEIQTLEEN... 186
12 -12.600PF05616.13; Q9JYD9_NEIMB/10-516; Neisseria meningitidis TspB protein  ali follow..  253.LKVDANPDKYIKATGYPGYSEKVEVAPGTKVNMGPVTDRNGNPVQVVATFGRDSQGNTTVDVQVIPRPDLTPGSAEAPNAQPLPEVSPAENPANNPNPNENPGTSPNPEPDPDLNPDANPDTDGQPGTRPDSPAVPGRTNGRDGKDGKDGKDGGLLCKFFPDILACDRLPESNPAEDLN 431
13 -12.600PF15782.5; H2M7V5_ORYLA/1-1933; Gene regulated by oestrogen in breast cancer  ali follow..  209.VINAGCGSCCSVSSSSFSLLLCCSPISFAPSATVMKRSDTGRIGAKEIGMAGPHVDQQTTDLAHTLINGNHSAPSSAQSSLNQPGRSSAPATHTNAGPPKKRHKGWSPDLSANSLQESTVKSPPASLSLSTLSVSSVVTPSAAIFPPLQLSVTVP--DQLLHTCRLQPVILKGHGPLP. 384
14 -12.500PF03286.14; Q9Q8M7_MYXVL/1-193; Pox virus Ag35 surface protein  ali follow..  27...STTETATADDIFPEDIEIPSPKQSKTKRAPAPRKKPTPKTSKKKEEEPQPPPKEEEVKESDEEEEIVEESPKSPPESPHTTQNTSAAVDACDTMDSS................................................................................ 123
15 -12.300PF08193.11; B2B4D8_PODAN/1-233; INO80 complex subunit Ies4  ali follow..  3.......................PSSKSAAAAKDRRKSNNNSAGLVTLRVPSAKLRAIVDPDYVKEDSPVKESPA----TSTTLPAATVNSTTENASDSSPNTPAAGTPAPPSVSMGPPAEGPKKKGVKRGAAALNGEPKVRGKPGPKKKQR............................ 127
16 -12.200PF07432.13; D6YTW7_WADCW/2-121; Histone H1-like protein Hc1  ali follow..  62............KKKAVKKTAKKAVAKKPAKKAAAKKKPAAKKAVAKKTTAAKKPAAKQAVKKPAKKKA............................................................................................................... 118
17 -11.900PF17371.2; Q4Q1V2_LEIMA/101-766; Family of unknown function (DUF5393 topsan)  ali follow..  17FFSFAPLSSTVDKSRHTSYQHRSECQVRDLFTLIMLLFPECFIAETLPRTPLETREAEGSVSETQSSNRAESEVQHPSSVSRVSPPVSPTPPILPRGRCTPSAQRTQTSVTEGRGIVVDAVSPSNSAVDAALGGFHAAPLEGSLGVLTPAKLVTTDAGATDGEVSSASASMTANMMPLPI 199
18 -11.800PF04929.12; VG59_EHV2/8-414; Herpes DNA replication accessory factor  ali follow..  289...................RANPQVDFNGVPEGDVQTQEVSSVASTCRHLSESCSLDPPRPELPGSPDTFKEIPGRSGSVHLERDLSCSDSEEETPKQKPAKAKPAAAPKRSEKRKREGGKKGPKAKSLKLTFNP............................................. 405
19 -11.700PF07174.11; V5XE16_MYCNE/1-285; Fibronectin-attachment protein (FAP)  ali follow..  14  3...........................QSDVNSSHRRRRTAGLLAAAAAGATAAALTLPVAVSHAEPVPAPPPPVPAEPAPAPGTPAPAPGAPAPTPLPPGVPPPPADPNAPPVDPNAPPPPAPEP...................................................... 101
20 -11.300PF05782.11; H0WRX2_OTOGA/1-562; Extracellular matrix protein 1 (ECM1)  ali follow..  10  19.VASEGDLKAPGQRELRPEHFMQHFHEVGYAAPPSPPLSQSLPMDHPDASQHGPLLEGQSEVQPLPPQEAIPVQEEEMPPPQVPLEKTDLPHPQEAIPAQEENLPPPQLSIEQKEVEPALSQAEMIFQPKQREGKPAALVSQSHPEPETWNPAQHCQRGRSRGGWSHRLDGFPPGQPSS. 196
21 -11.300PF04642.12; Q9C631_ARATH/201-502; Protein of unknown function, DUF601 topsan  ali follow..  2........AGTLEDSKLRSLEKTKYQPSDSGSRPETPTSVSAGKKPETPTSGSGKALKDPAGKDPEKRAADKKRKQPEEISHSPPRSSRPRQEEKGAKLKGVVEDAPQNLVVLSSRESETRESERRNVPLPAPPMTFADTMRTLVPPGSAIAP........................... 146
22 -11.200PF06012.12; C0NJY7_AJECG/119-508; Domain of Unknown Function (DUF908 topsan)  ali follow..  13  94........PKPAPAKVTDTSSASVKGKEKAIQAQTDRRGSVTKCNANDLIALTKGLSDTEPNGFAAHDWEEWANSPSPDAAEDAAPAGAGAIPHPPATPTPLRRSSTHPSSRLSRSSVTDDSPTAPPTSSPTSKYDETNRGVK..................................... 234
23 -10.900PF06020.11; B3MY94_DROAN/41-405; Drosophila roughex protein  ali follow..  224..PQTDDEGEEVPQARSLSVRRILFADGADEDGDEDTDGSVEEKKDDASEPDLPDQNQEEDKDEPEQQGEQEEQQQQQPEEAPASSSSSTAQEETNPPAEPIVGERNPPEKSIICSLTPRKRTQTTNVCEVEPKRTPLRTR....................................... 362
24 -10.600PF01265.17; E4V2Y5_ARTGP/1-312; Cytochrome c/c1 heme lyase  ali follow..  12  6.......................ASTTPAVKQPEIPTPSPSDAAPSRCPVQHGQSMNINATATSEGSCPVRAKDSPFYVPPSNSARLE-DATPSAPEPEQKSILSKLNPLNYMFADISQTRAPNQTVDLSVEREPSSIPRGDNSGAKWEYPSPQQMYNAMLRKGYTDTPQD......... 152
25 -10.400PF08192.11; SSY5_YEAST/2-693; Peptidase family S64  ali follow..  6LNKKKNEEKENTDLPADNEQNAAETSSSNVSGNEERIDPNSHDTNPENANNDDASTTFGSSIQSSS---SRGRMTYGTGASSSMATSEMRSHSSGHSGSKNSKNLQGFKDVGKPLRAVSFLSPVKEEESQDTQNTLDVSSSTSSTLATSENARENSFTSRRSITLEYIHKS......... 175
26 -10.100PF15292.6; TICRR_HUMAN/208-1004; Treslin N-terminus  ali follow..  629..SGSPESDELQELRTRSAKKRRKNALIRHKSIAEVSQNLRQIEIPKVSKRATKKENSHPAPQQPSQPVKDTVQEVTKVRRNLFNQELLSPSKRSLKRGLPRSHSVSAVDGLEDKLDNFKKNKGYHKLLTKSVAETPVHKQISKRLLHRQIKGRSSDPGPDIGVVEESPEK......... 797
27 -9.920PF05300.11; I3JPR6_ORENI/13-258; Protein of unknown function (DUF737 topsan)  ali follow..  24.............................................................................LSPEVVSPHLAPASKTVASPDPTSSVEHLSPPPPTVIAAPPPSLSPPSQGATVPTVEPAPSAPPPPATIIALFVSSQVSEDELRQKLKEEMQRSLKEEIDQKR 126
28 -9.920PF08580.10; V5HV84_BYSSN/491-1186; Yeast cortical protein KAR9  ali follow..  10  519.SPTRSQTNPSFTPRPASRTSTAPTKTPDNRPRWNSSTNTNDLNIGHTHKTLSATTPSRNPNRNSRSNIPTPSPLSREASRSPVPPHMRSSSRAMSRLASPTPNRLYSPTPSRSILDPPPYSKLRKQSTPNLPTGARNRQSYAGISITRSSPVEDRTKTQRPETSLGHSTASRRLSGIP. 696
29 -9.720PF10428.9; H6C681_EXODN/477-953; RAM signalling pathway protein  ali follow..  150FGADVKVTQGLGHRRQMSSGNTHPIQTIPEEFSTPSQPVRASTPTRDRHWPSRQIGRLRSDTAIQHAVVETNPGHQPNSVPPANTAVFPTPIQLSGSTLNGGLPTGTSTTFSNSGTMASSSTTSGLRSRSSSRNAQLINGLGSSSLASTPRSGEGFSLPQSTAYGVRVNPSTGLTDA... 326
30 -9.640PF15316.6; H3AQF3_LATCH/78-250; MyoD family inhibitor  ali follow..  1...QPHPLPHPTASALEQTEEETGKLQNGHVVLTNGSGIHNGVTHGAADHKKLPAPVSQKMHRKLQSSLSVSSDSSKRSKLSSTNSQKPGSSPED..................................................................................... 92
31 -9.600PF05262.11; M2CTJ8_TREDN/25-520; Borrelia P83/100 protein  ali follow..  183VVEKMREDKGKDLEKRKEMVDLKERESEEAAKRAEVAKKEADVKQKEADKQKKEADTKQKAAEKQKKETEQKQKEAKKAEEKAATTGKPEDKKVAEEKKKEAEKSQKETEKKTEEAKKAKDAADEKQKKADEAKKEVKEEEKMAEKKTEEAQTDRKDIASDTQKIIEEKKAEKKAEGDAA 362
32 -9.500PF03082.14; MS2A_DROME/1-264; Male accessory gland secretory protein  ali follow..  16...........................TVASCDSEQQLDSAMHLKSDSTKSASLKNVAPKNDETQAKIAKDDVALKDAKKGDYIMDIDISDLP-LDDYPINRSKSLKSSSIDLNNIPFNKGLDDFPAKEKNQGSNQSALKALQQ.................................... 131
33 -9.450PF14962.6; H0WJV0_OTOGA/1-192; Mitochondria Localisation Sequence  ali follow..  85...................................TKAELHPLQGEKEHIAEAEKASPEAPEVSVVEAEVVAAEEIPDATVAALTEASACPGGVEAAPETAASGAETAPEVPEAVVGDTTEEVSAGTTPEVTDPTLGEAVA....................................... 190
34 -9.260PF06193.11; A4_VAR67/1-271; Orthopoxvirus A5L protein-like  ali follow..  85.TPAPTPKPRQQQTNTSSDMSNLFDWLSADDNTQPSSLLPALTPINAVQDIISKFNKDQKTTTTPSTQPSQTLPTTTCTQQSDGSISCTTPTVTPPQPPIVATVCTPTPTGGTVCTTAQQNPNPGATSQQN................................................. 214
35 -9.080PF08549.10; E3Q6J3_COLGM/3-717; Fungal domain of unknown function (DUF1750 topsan)  ali follow..  475.PPPASSLPPAAGADTGALGSRRPSQAGSTHSGVMVGDSDIDMGGTAAGLLDEMHTGFSANSTPLNNFPTPQTHMSALNSTAGTPANANAPSPAPVPPTIPEETETQASAGASAGAAEDVTMGNTGSTKNTPATAPDHGTGSGEWVVVPKGGTSPDPGAGAATSTGATEGDEPKAAAKIP 653

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.