current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|O15254|ACOX3_HUMAN Peroxisomal acyl-coenzyme A oxidase 3 OS=Homo sapiens GN=ACOX3 PE=1 SV=2 (Range: 301-600), from H.sapiens

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst LGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYLAAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREIHALASASKPLASWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQTSNYLLGLLAHQVHDGACFRSPLKSVDFLDAYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEARNKCQVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSLLast
1 -77.000[I] KOG0136 Acyl-CoA oxidase  ali follow..  27  275YGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGD-----LSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYL-NDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLV-RASEAHLHYGLVKLFSEKLLKIQ-DKAIQAVLRSLCLLYSLYGI 567
2 -74.200[IQ] KOG0135 Pristanoyl-CoA/acyl-CoA oxidase  ali follow..  31  329LAPLTSGRVTIASSAIYSAKLGLAVAIRYSLSRRAFSAANGPEVLLLDYPSHQRRLLPLLAKTYAMSFAVNDLKMIYVK------------RTPETNKAIHVVSSGFKAVLTWHNMRTLQECREAVGGQGLKTENRVGHLKGEYDVQTTFEGDNNVLMQLVSKALFAEYVSCKKRNKPFKGLGLEHM-------------NSPRPVLPTQLTSSTLRCSQFQRDLLERFTSEVAELQGRGESREFLFLLNHQL-SEDLSKAFTEKAILQTVLDAEAKLP-PGSVKDVLGLVRSMYALISL 602
3 -26.200[E] KOG0138 Glutaryl-CoA dehydrogenase  ali follow..  18  287FGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGV------PLARNQLIQKKLADMLTEITLGLHACLQLGRL-----------------KDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITG..................................................................................................................................... 430
4 -26.100[I] KOG0139 Short-chain acyl-CoA dehydrogenase  ali follow..  18  278IECLNAGRIAIGAQMIGLAQGCFDQTIPYLQQREQFGQ------RLIDFQGLQHQIAQARTEIEAARLLVYNAARM-----------------KEYGIPYVREAAMAKLFASQVATSTSAQCVKWLGGVGFTKEFPAEKFYRDAMIGEIYEGTSNIQLNTIAKLIDNEYKWK................................................................................................................................ 426
5 -25.900[I] KOG0140 Medium-chain acyl-CoA dehydrogenase  ali follow..  18  264MEAFDMTRPGVAAGALGLSWRCLDESAKYALERKAFGT------VIANHQAVQFMLADMAVNLELARLITYKSAND-----------------VDNKVRSSYNASIAKCFAADTANQAATNAVQIFGGNGFNSEYPVEKLMRDAKIYQIYEGTSQIQRIVISRMLLGHFAQ................................................................................................................................. 411
6 -25.100[I] COG1960 Acyl-CoA dehydrogenases  ali follow..  18  245FTCLNSARYGISWGALGAAEFCWHTARQYVLDRQQFGR------PLAANQLIQKKLADMQTEITLALQGCLRLGRM-----------------KDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGIARHLVNLEVVNTYEGTHDVHALILGRAQTG..................................................................................................................................... 388
7 -24.500[EI] KOG0141 Isovaleryl-CoA dehydrogenase  ali follow..  18  264MSGLDLERLVLAAGPLGIMQACLDNVLPYIRQREQFGR------PVGEFQFIQGKVADMYTALQSSRSYVYSVARD-----------------CDNGKVDPKDCAGTILCAAERATQVALQAIQCLGGNGYINEYATGRLLRDAKLYEIGAGTSEIRRIVIGRELFKE.................................................................................................................................... 408
8 -24.100[R] KOG1469 Predicted acyl-CoA dehydrogenase  ali follow..  12  236QGRLGPGRIHHCMRTVGLAERALQIMCERATQRIAFKK------KLYAHEVVAHWIAESRIAIEKIRLLTLKAAHSMDT---------------LGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAK............................................................................................................................ 390
9 -21.600[I] KOG0137 Very-long-chain acyl-CoA dehydrogenase  ali follow..  14  297MNILNSGRFSMGSVVAGLLKRLIEMTAEYACTRKQFNK------RLSEFGLIQEKFALMAQKAYVMESMTYLTAGMLDQ---------------PGFPDCSIEAAMVKVFSSEAAWQCVSEALQILGGLGYTRDYPYERILRDTRILLIFEGTNEILRMYIALTGLQHAGRILTTRIHELKQAKVSTVMDTVGRRLRDSLGRTVDLGLTGNHGVVHPSLADSANKFEENTYCFGRTVETLLLRFGKTIMEEQLVLKRVANILINLYGMTAVLSRASRSRIGLRNHDHEVLLANTFC.... 572
10 -6.150[L] COG1421 Uncharacterized protein predicted to be involved in DNA repair  ali follow..  31..........YADTGGYADVIARANNLKTTQLRKFFSAIRSMEKKADSWKSIEADFY-LLKPQLANARGRDLIPEGFYEVMKKMMDKVDRGDDDEKIENFRVFVRFLESIVAYH---------KFYNPRS.......................................................................................................................................................................... 140

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.