current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|O15254|ACOX3_HUMAN Peroxisomal acyl-coenzyme A oxidase 3 OS=Homo sapiens GN=ACOX3 PE=1 SV=2 (Range: 451-700), from H.sapiens

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst EGDNNILLQQTSNYLLGLLAHQVHDGACFRSPLKSVDFLDAYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEARNKCQVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSLSRHAALLYRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKLLast
1 -58.300[I] KOG0136 Acyl-CoA oxidase  ali follow..  24  421EGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYL-NDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVD-LVRASEAHLHYGLVKLFSEKLLKIQ-DKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQV-NQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVH--ESYKHLKSLQ----SKL 660
2 -46.900[IQ] KOG0135 Pristanoyl-CoA/acyl-CoA oxidase  ali follow..  23  468EGDNNVLMQLVSKALFAEYVSCKKRNKPFKGLGLEHM-------------NSPRPVLPTQLTSSTLRCSQFQRDLLERFTSEVAELQGRGESREFLFLLNHQL-SEDLSKAFTEKAILQTVLDAEAKLP-PGSVKDVLGLVRSMYALISLEED-PSLLRYGHLSRDNVGDV-RKEVSKLCGELRPHALALVASFGIPDAFLSPAFNWVEANAWSSL.................................. 667
3 -6.960[T] KOG0034 Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein  ali follow..  12  73...................................................................FSVNEVEALYELFKKLSCSIIDDGLIHKEELRLALFQAPYGENLFLDRVFFEEFIHALSVFHPYASIQEKTDFAFRLYDLR----------QTGFIEREEVQQMVSAILLESDMMLSDELLT-----MIIDKTFADADSDKDGKIKDEWNVYVHKHP.......................... 227
4 -6.050[R] KOG4350 Uncharacterized conserved protein, contains BTB/POZ domain  ali follow..  2........................SNSHPLRPFTAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCQYFRALLYGGMRES--QPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTI-LNIQNVCMTFDVASLYSLPKLTCMCCMFMEGFALLNIVLRDSFAAPEKDIFLALLNWCKHNS-----------KENHAEIMQAVRLPL 229
5 -5.750[R] KOG0038 Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily)  ali follow..  53...........................................................................ILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMPELRFEDFLDALSVFSEQAPRDIKVFYAFKIYDFD----------QDGFIGHADLMSCLTTMTKNELSPEEHQQIA--------DKVIEEADVDGDGKLILEFEHVILRAP.......................... 196
6 -5.280[V] COG1680 Beta-lactamase class C and other penicillin binding proteins  ali follow..  51......................................................................MALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQG--TVKLNDPLSKYAPPGARVITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWKYLSTAKLKA-SQAAYSNLLLADALANASGKPYTQLFEEQITRPLGMKDTTYTPSPDQCRRLMVAERGA. 239
7 -5.260[L] COG0817 Holliday junction resolvasome, endonuclease subunit  ali follow..  13  16................................................................................................................................................YGVIRQAGRHLEYLGSGVIRTSVTDKRIYMGVNEIILQYQPDMFAIEEVFLAKNANSALKLGQARGPVFEYAARLVKQTVVGIGSADKIQVQDMVTRILT...... 131
8 -5.110[P] COG2703 Hemerythrin  ali follow..  4...............................................................................................KWDNSYSVHNAKIDEQHKKLFLAAKVEVVSDRSVSKNEVKELLAEFFN-YMKDHFNDEEKYMQLIGY-EHRKIHKEIIQTMINLIKDIKSTNDLKEKLYIVAKKWLLEHILYEDMKVEKWRSSSLSTDDGGDVS..................... 140
9 -5.070[P] COG0704 Phosphate uptake regulator  ali follow..  12.......................................................EELKYLTHKIAEMGGHAERMVEQSVAAIVNADNALAQRVISDDLILDASEREIDDKAVMIIAKRQ--------PMAVDLREIIGSIRISADLERVGDLGKNIAKR-AVSESRQPVKLYRGLETLAELALTQLKEVLDAYASRSVQQINVVRDRDDEIFRELLTYMMEDPRNISA..................... 185
10 -5.070[R] KOG4591 Uncharacterized conserved protein, contains BTB/POZ domain  ali follow..  100..................................................................................................KSEIQISDDVDFEAFHVAIRWIYTDEIDLKMEDEKLLKVCE-TATSFRLEQLKNVCVQQLGAR-LHVDNCIKIYEFAEKQSLRQLSTVAGSMIHFAQMTAALLYRLIDGNTKNVLHSIVSIGRED........................... 232

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.