current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|P07108|ACBP_HUMAN Acyl-CoA-binding protein OS=Homo sapiens GN=DBI PE=1 SV=2, from H.sapiens

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGILast
1 -62.200[I] COG4281 Acyl-CoA-binding protein  ali follow..  48  1MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYS. 86
2 -18.300[I] KOG0817 Acyl-CoA-binding protein  ali follow..  39  41CLAELFEKAAAHLQGLIQVASREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKKLDPGWN. 126
3 -6.600[S] COG4508 Uncharacterized protein conserved in bacteria  ali follow..  18  2....NLNKLFHLQKNLDTKIIDQKNLSSQNLYSQKALA--------FGELASKTRFNYWTTEAPCEKNAILEEYINCLHFILS.... 77
4 -6.110[S] COG4681 Uncharacterized protein conserved in bacteria  ali follow..  18  17LDRNQFLDASLTLARHPSETQERMMLRLWLKYADETRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKK............... 94
5 -5.910[J] COG5225 Uncharacterized protein involved in ribosome biogenesis  ali follow..  14  43LSRDNVQQLVNKMISLPKERTSDGVL--LQLPETVTPLPRAKPLP---KPKPETKWQRFARIKGIAPKKREGRLVEASGEWVPKWG. 125
6 -5.610[L] KOG2475 CDC45 (cell division cycle 45)-like protein  ali follow..  12  296......RAHGKTPHDQSIRLEDEFRFMLVSLYDSMLHSAYVGSRLHIWSEEGRKRLHKLLAKMGLSLVECKQTYKSSLKRFAPFYGL 390
7 -5.440[S] COG3068 Uncharacterized protein conserved in bacteria  ali follow..  17  1MLQNPIHLRLERLESWQHVT--ERMYPNYAMFCQQT-------GFGDGQIYRRILDLIWETLTVKDAKVNFDSQLEKFEEAIPS... 81
8 -5.380[S] COG4499 Predicted membrane protein  ali follow..  23  321NGRGEFGKSLDIAKLL-----DDPTLAMYSLTKQIEQVQSD------------------TKLSGDEKVERLKTLEENLKEYDEKVN. 383
9 -5.330[B] KOG4715 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin  ali follow..  20  153..............KPPDKP-----LMPYMRYSRKVWDQVKASNPDVLWEIGKIIAGMWQDLADEEKEVEKIEYNESMNAHHNS... 224
10 -5.250[J] KOG1765 Regulator of ribosome synthesis  ali follow..  12  44EGTKLVQEIANKLFNFPSTETNDGPI--VQLPPPTTKLPREKHIP---RPKPPTKWEEFALKKGIQKKKEKVVWDEQTNQFKRRHG. 125

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.