current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q99490|AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=AGAP2 PE=1 SV=2 (Range: 151-450), from H.sapiens

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst GGPEPEGRTGGGVPGSSSPHPGTGSRRLKVAPPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASVSAAATAAAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPPTPSPATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPPGSGPLPGPPSLSSGSGSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGLast
1 -15.900[R] KOG2350 Zn-finger protein joined to JAZF1 (predicted suppressor)  ali follow..  673.VGMHKKQEDPKTLKSPQKPAPPADQASTSSASTSGSGSGSSSMQPPKRMPAHLKRGSAASSPGVQSKGTENGTNGSNSSSSNSKNVAKKSADQPLSTLANTRERRSEYGQKRNVSGSRLAATPASKRKLSSKDVEQAADAPEVLTHSDNAVDVGIIDDECGGFGAVGVMNGVASPVANNSEMDTEAEVEAEPTATKAITIHCQQPVTTPVAAAATANERLPGVAPHRRGPRRADRREEELVASAPGYRCRPSMRGADAGAAAAAAAAPTH------PHRPPPPPPPQ............ 955
2 -8.740[E] COG4917 Ethanolamine utilization protein  ali follow..  27  3.................................................................................................................................................................................................................................................................RIAFVGSVGAGKTTLFNA-LQGNYTLARKTQAVEFNDKGDIDG 46
3 -8.390[S] KOG4610 Uncharacterized conserved protein  ali follow..  316......................AEFWKNRRESRMAKSRQFQSRRKVQDADQNSIYMISNERGGDVKKKIKRAKDKDYAEQEAVYSKKKKDKKDKKKRKRKDTGYSTASSQNLYSTKASGTDKDTRRKDKKGKKSKRTCSSSPSDCDLAKKQKRKNADKNDKKKSRKIEAVVEESSSSSSSSSDSSNSTLPSYEVIDEKKARRRKHRGSSSDTSSGDSSSSSSSSSSSDSS...................................................................... 523
4 -7.960[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  13  450......................................................................................................................EQTLARQTSLPSLSSDSSLSMSIGRGHWGGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPPKPKVQIPGLNRPQIADPKQGKKSSTQDTNVHDNLRELNTTSGG-QKQLLFHG 638
5 -7.810[R] KOG0395 Ras-related GTPase  ali follow..  25  2..............................................................................................................................................................................................................................................MKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTEDFHRKVYNIRG 64
6 -7.680[R] KOG0393 Ras-related small GTPase, Rho type  ali follow..  23  1.............................................................................................................................................................................................................................................................MQAIKCVVVGDGAVGKTCLLLSYTTNAFPGEYILT-DTYSTNVMVDG 48
7 -7.500[R] KOG4227 WD40 repeat protein  ali follow..  11  626.......................................SSSPTSSPERSTSTLEIQPSRASPTSDIESVERKIYKAYKWLRYSYISYSNNKDGETSLVTGEADEGRAGTSHKDNPAPSSSKEACLNIAMAQRNQDLPPEGCSKDTFKEETPRTPSNGPGHEHSSHAWAEVPEGTSQDTGNSGSVEHPFETKKL-KALSSRAEEPPSPPVPKASGSTLNSGSGNCPRTQSDDSEERSLETICANHNNGRLGQNLGELEVVAYSSPGHSDTTLLHKDCCGSEMACETPNSGRQRIEL-TDS 931
8 -7.120[R] KOG2295 C2H2 Zn-finger protein  ali follow..  260..............VIKLEGGTDEDLKVLDEKPKDPVVYERKAEQMQSVKEVEKTINSPKEEMSEADPVSTQRKPVRPVNSDGENWDDDDAENSAPKKELAEDSKDSDSKPEDKQLNKKKTKKRKRNSSDDDSSSSESSSSSDEEKLKEKYDVEDGLRAEQKTEAEKDRQEATKAKQGPQSPKLDEDEGNENTEPKGLDSKINTYEEIDNTLKSPEISSNPIKNTDNGDGSKVEEDGEKPSVGKDKVVETETIDLDKVKDGQPRALHRTSSIFLRNLAPSITRSEDPLVERFMRDVNIK. 570
9 -7.110[TU] KOG3895 Synaptic vesicle protein Synapsin  ali follow..  11  664KSGSAASIHTSSSSSISSSSISSRINRNGNAIQSPPPPAGPPPPPPTNVTAVGSNANSSSGYRNSFSSSLSKDKTSYGNYGSTTSVETITRMDTNTTNIGATATEAGEASGVTAITNISNSDGIVAPTTGTITTSVTTNDWRSAIGMRSASVYSAPAAVTTVLPGDTSGYDSNSIASQGEGLNNPSDLPSYTRPSYSRSESNASKHSDLDVIFGDSKTTPASYGNGKYTRAAGSISDADPSNYKTDRFGASKSMSMTSGGVGSGNGSGSGL------MSSIGSHTKRWSASKEEDDELD. 984
10 -6.980[S] KOG4556 Predicted membrane protein  ali follow..  11  194..SGYLNSQYDDLGSSREKVKVTEKKEVKGQFERNSKKKKKNPRPEMPAPDCAPCSSNRSSEEESNLEDVYTQPIKKKIMPLRRPDLEEENRGTNVTSLVSFDPKSATLLRIRQHLEAEPSDRDTPDYDMYERLRSRSSGHSEVAPASTIPLSSDYKSRNASQDSVPSMFAPMLNSPAPSSTTSGSSSRTSGASLAHKTHIVGKGGISLSTVDPSPILSPGIRLSEQLGAKNQSYKSAFRVQKTENARVISHYHAPNEIPLSSDPSVVENESNYPVMTSG--------------GLLV.. 475

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.