current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q99490|AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=AGAP2 PE=1 SV=2 (Range: 451-750), from H.sapiens

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst QTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSLast
1 -43.800[R] KOG0394 Ras-related GTPase  ali follow..  20  55RLFTLQIWDTAGQERFQFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASSDPENFPFVLIGNKVDVDDGNSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSGEEEELYLPDTIDVGTSNQQRST.............................................................................................................................................................. 202
2 -42.400[R] KOG0395 Ras-related GTPase  ali follow..  21  65DMYQLDILDTSGNHPFPSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSKEAAELPMVICGN--KNDHELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRP.............................................................................................................................................................. 216
3 -42.300[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  14  56KRIKLQIWDTAGQERFRYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHAS---ENVYKILIGN--KCDCEDQRQVSFEQGQALADELG-VKFLEASAKTNVNVDEAFFTLAREIKKQKIDAENEFSNQANNVDLGNDRTVK............................................................................................................................................................. 197
4 -42.300[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  18  55KTIKLQIWDTAGQERFRYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYAS---ENVNKLLVGN--KCDLTSQKVVSTETAKAFADELG-IPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGSKPPTVQIRGQPVNQQ............................................................................................................................................................. 196
5 -41.300[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  19  56EKVKLQIWDTAGQERFRYYRSANALILTYDITCEESFRCLPEWLREIEQYAS---NKVITVLVGN--KIDLAERREVSQQRAEEFSEAQD-MYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCN......................................................................................................................................................... 201
6 -41.200[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  22  57QRVKLQIWDTAGQERFRYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNC----DSVQKVLVGN--KCEENERRVVLESDARNYAQSMN-ISFFETSAKEDKNVEPMFTCITSLVLTAKLANPQSASKDQ......................................................................................................................................................................... 185
7 -40.900[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  18  69KRIKLQIWDTAGQERYRYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSW---DNAQVLLVGN--KCDMEDERVVSSERGRQLADHLG-FEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQ....................................................................................................................................................... 216
8 -40.800[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  20  67TTVKFEIWDTAGQERYHYYRGAQAAIVVYDITNEESFARAKNWVKELQRQAS---PNIVIALSGN--KADLANKRAVDFQEAQSYADDNS-LLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPT............................................................................................................................................................. 208
9 -40.700[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  19  66QRIHLQLWDTAGQERFRFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHA--YCENPDIVLCGN--KSDLEDQRVVKEEEAIALAEKYG-IPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKG.................................................................................................................................................... 217
10 -40.600[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  16  55NKAKLAIWDTAGQERFRYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYC--TRNDIVNMLVGNKIDKE---NREVDRNEGLKFARKHS-MLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGG............................................................................................................................................................. 196
11 -40.400[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  16  59CQADLHIWDTAGQEKYHYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLG---NTAEILIVGN--KIDLEEERQVTRQDAEAYAESEG-ALYMETSAQDNVGISDAFESLTAKMIEHSRTRSTEPPSTNRSIRLIDNDEAERSKK......................................................................................................................................................... 204
12 -40.300[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  17  58QKIKLQIWDTAGQERFRYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTN---PNTVIILIGN--KADLEAQRDVTYEEAKQFAEENG-LLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSA................................................................................................................................................................ 196
13 -40.200[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  12  53KQIKLQIWDTAGQESFRYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSN---SNMVIMLIGN--KSDLEARREVKREEGEAFAREHG-LVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNEANGIKLGPQHSPS............................................................................................................................................................. 194
14 -40.100[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  16  55KTVKLQIWDTAGQERFRYYRGAAGALLVYDITSRETYNSLAAWLTDARTLAS---PNIVVILCGN--KKDLDPEREVTFLEASRFAQENE-LMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMG......................................................................................................................................................................... 184
15 -40.000[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  21  57KKIKAQIWDTAGQERYRYYRGAVGALIVYDITKQSSFDNVGRWLKELREHAD---SNIVIMLVGN--KTDLLHLRAVSTEEAQAFAAENN-LSFIETSAMDASNVEEAFQTVLTEIFRIVSNRSLEAGDDGVHPTAGQT................................................................................................................................................................. 194
16 -39.800[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  16  56RTVRLQLWDTAGQERFRYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERA---GDVIIVLVGN--KTDLVEKRQVSIEEGDSKGREYG-VMFIETSAKAGFNIKPLFRKIAAALPGMESYSNTKNE............................................................................................................................................................................ 182
17 -39.200[T] KOG4252 GTP-binding protein  ali follow..  21  56EDVRLMLWDTAGQEEFDYYRGAQACVLVFSTTDRGSFEAVSSWREKVVAEV----GDIPTVLVQN--KIDLLDDSCIKNEEAEALAKRLR-LRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTNKNRN............................................................................................................................ 229
18 -38.800[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  19  57TQIKLQLWDTAGQERFRYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHI--EPHRPVFALVGCKLDLNAGGHREVTTEEAQKFAKQHG-LHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDG.......................................................................................................................................................................... 189
19 -37.100[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  16  59GEIKFDVWDTAGQEKFGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC----ENIPIVLCGN--KVDVKERKVK--AKTITFHRK-KNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLE................................................................................................................................................................................. 177
20 -34.800[R] KOG1673 Ras GTPases  ali follow..  18  147VTISFSIWDVGGDEK-IACKDAVAILFMFDLTSRSTLNSVFGWYSQARKWN----KTAIPILIGT--KFDDPNLQWTIVTQARAYAKVMN-ASLFFSSATHNINVNKIFKFILARLFNLPWKIDRNLTLGE......................................................................................................................................................................... 281
21 -33.600[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  16  516TRVKLQIWDTAGQERFRYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYA---QEDVVIVLIGNKADCS-GSERQVKREDGERLGREHN-VPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHDFVRDNTKARS............................................................................................................................................................. 658
22 -30.600[R] KOG0393 Ras-related small GTPase, Rho type  ali follow..  20  49RPINLSLWDTAGQDDYDQFRQTDVFLVCFALNNPASFENVAKWYPEVSHH-----PNTPIILVGTKERLRESRLQPVSHTQGYVMAKEIKAVKYLECSALTQIGLKQVFDEAIRTGLTPPQTPQTRAKKSN......................................................................................................................................................................... 191
23 -26.300[R] COG2229 Predicted GTPase  ali follow..  59EDTKVHLYGTPGQERFNLSQGSMGLVLLLDNARTNPLKDLEFFLHSFRGLL----EKAPVVVGIT--KMDIRSQPGIDVYHKYLAKHNLN-VPVFEIDARKEDDVKQLVSAMLFSIDPGLE................................................................................................................................................................................... 177
24 -22.200[T] KOG3886 GTP-binding protein  ali follow..  115GNLVLNLWDCGGQDTFMIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNS-PDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSR--SCFRTSIWDETLYKAWSSIVYQLIPNVQQ.................................................................................................................................................................................. 247
25 -19.300[S] KOG4273 Uncharacterized conserved protein  ali follow..  14  52.TADVSVCISHICDEYSNSHPLVALVMVFDLSELSTLVALQDWVSHTDINSFD------LLCIGN--KVDRVPHHLAHDEYRRRLLKDIDDFGISETEGSSLLGSEDASLDIRGACLE...................................................................................................................................................................................... 176
26 -19.200[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  10  59DRIPATVIDTSSRPEDK-VRQADAIVLTFAFDRPETLDRLSKWLPLFRQL----EVRVPIIVAGYEVDNKEAYNHFIEQITSALMKQYREVETSIQWSAQRLDQAKDVLYYAQKAVI....................................................................................................................................................................................... 178
27 -17.300[T] KOG0705 GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains)  ali follow..  24  28ESEIYEAGAEDRMAGAPMAAAVQPAEVTVEVGEDLHMHQVRDREMPEALEF--NPSANPEASTIFQRNSQ-TDVVEIRRSNCTNHVSTVRFSQQYSLCSTIFLDDSTAIQHYLTMTIISVTLEADRSLSIPDEQLHSFAVSTVHIMKKRNGGGSLNNYSSSIPPTPSTSQEDPQFSVPPTANTPTPVCKRSMRWSNLFTSEKGSDPDKERKAPENHADTIGSGRAIPIKQGMLLKRSGKW-LKTWKKKYVTLCSNGVLTYYSSLGDYMKNIHKKEIDLQTSTIKVPGKWPSLATSA.... 328
28 -17.000[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  11  63GNVTIKVWDIGGQPRFRYCRGVNAIVYMVDAADLDKLEASRNELHSL--LDKPQLAGIPVLVLGNKRDLPLDETGLIERMNLSSIQD--REICCYSISCKEKDNIDITLQWLIQHSKSQSR................................................................................................................................................................................... 186
29 -16.900[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  69...ILKFWDVGGQESLRYYSLCHGIIFIVDSSDRERLDECSTTLQSV--VMDEEIEGVPILMLANKQDRQMEVQDIKEVFNKIAEHISARDSRVLPISALTGEGVKDAIEWMIVRLERNKKSRP................................................................................................................................................................................ 194
30 -16.500[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  14  59QGFKLNVWDIGGQRKIRYFENTDILIYVIDSADRKRFEETGQELAEL--LEEEKLSCVPVLIFANKQDLTAAPASEIAEGLNLHTIRD-RVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK................................................................................................................................................................................... 182
31 -16.000[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  15  59KNLKFQVWDLGGQTSIRYYSNTDAIIYVVDSADRDRIGISKDELLYM--LREEELAGAILVVLANKQDMGCMTVAEVHHALGLENLKN-RTFQIFKTSATKGEGLDQAMDWLSNTLQSRK.................................................................................................................................................................................... 181
32 -16.000[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  14  63KNIKFNVWDVGGQDKIRYFTGTKGLIFVVDSADSNRISEARQELHRI--ISDREMRDCLLLVLANKQDLGALSPAQITDVLQLDKLKD-RLWNVQPTCALTGDGLLEGLAWLSQNAKLK..................................................................................................................................................................................... 184
33 -15.800[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  15  60KNLKLNVWDLGGQTSIRYYADTAAVIFVVDSTDKDRMSTASKELHLM--LQEEELQDAALLVFANKQDQGALSASEVSKELNLVELKD-RSWSIVASSAIKGEGITEGLDWLIDVIKEEQ.................................................................................................................................................................................... 182
34 -15.700[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  15  58RGFKLNIWDVGGQKSLRYFESTDGLIWVVDSADRQRMQDCQRELQSL--LVEERLAGATLLIFANKQDLGALSSNAIREALELDSIRS-HHWCIQGCSAVTGENLLPGIDWLLDDISSRIFT.................................................................................................................................................................................. 182
35 -15.700[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  11  59KNISFTVWDVGGQDKIRYFQNTQGLIFVVDSNDRDRVVEARDELHRM--LNEDELRDAVLLVFANKQDLNAMNAAEITDKLGLHSLRQ-RHWYIQSTCATSGEGLYEGLDWLSNNIASK..................................................................................................................................................................................... 180
36 -15.400[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  14  62GKIKFKAFDLGGHQIARYYAKVDAVVYLVDAYDKERFAESKRELDAL--LSDEALATVPFLILGNKIDIPASEDELRYHLGLTNFTTGKGKVTVFMCSIVRKMGYGEGFKWLSQYI........................................................................................................................................................................................ 192
37 -12.500[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  13  107KVKPVHLIDVPGHSRLIYLPRAAAVVFVVDALELPNIRAASEYLYDILTNASVIKNKTPVLLCCNKTDKTAHTKEFIRKQEVFSFSHCHNKVTVAEASGLTG-ETDQVQEFIREHV........................................................................................................................................................................................ 258
38 -11.000[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  19  111..VNFQIWDFPGQIDFFIFRGTGALIFVIDSQDDYM-EALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADLSFYLTSI-YDHSIFEAFSKVVQKLIPQLPT.................................................................................................................................................................................. 243
39 -9.230[R] COG1084 Predicted GTPase  ali follow..  207KWKRIQVIDTPGLLDVALENIADVIMFIFDASETCGYTLESQY----LYLGIRSVFDIPVVTV---NKMDLAENVKYLEEYINMVE------DPLKVSAFEGRGVSKIIKKLEGLYEKETREAHDN.............................................................................................................................................................................. 335

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.