current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q9H013|ADA19_HUMAN(removed signalp:1-25) Disintegrin and metalloproteinase domain-containing protein 19 OS=Homo sapiens GN=ADAM19 PE=1 SV=3 (Range: 301-600), from H.sapiens

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst GGVNMDHSENAIGVAATMAHEMGHNFGMTHDSADCCSASAADGGCIMAAATGHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGGRRCGNGYLEDGEECDCGEEEECNNPCCNASNCTLRPGAECAHGSCCHQCKLLAPGTLCREQARQCDLPEFCTGKSPHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDMNGEHRKCNMRDAKCGKIQCQSSEARPLESNAVPIDTTIIMNGRQIQCRGTHVYRGPEEEGDMLDPGLLast
1 -68.400[O] KOG3607 Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family  ali follow..  34  412RGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPT--KLFEPTECGNGYVEAGEECDCGFHVECYGLCCK--KCSLSNGAHCSDGPCCNSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKD-GDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSHQGRVIDCSGAHVVLDDDTDVGYVEDG. 711
2 -64.000[W] KOG3658 Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases  ali follow..  23  409..VNYGNRVPARVSQLTLAHEIGHNFGSPHDFPAECQPGLPDGNFIMFASADKPNNGKFSPCSVKNISAVLAVVLKSMPVDPTRNASPVTSAFCGNQIYEPGEECDCGFSQAMGDKCCGPGPCKRKPGAQCSQGYCCDTCSLHGKNEEKIRQESECSNLQTCDGRNAQCPVSPPKHDGIPCQDSTKVCSSGQCNGSVEDCFLTEGKADELCFLACIKDGKCTSSVHLPEFSANRTNFLQNMRKDKPGLILHCNNYKGYCDIFR---------------KCRSVDAN.............. 719
3 -10.600[O] COG5549 Predicted Zn-dependent protease  ali follow..  18  188..IAIKPGLAPLSLQGTARHELGHALGIGHSDHKED---------ALYPAQTADV----PAISPRDLRTLYR------LYQQPT........................................................................................................................................................................................................................ 251
4 -10.400[S] KOG4791 Uncharacterized conserved protein  ali follow..  20  6........................................................................................................................EDCYFFFYSTCTKGDSCP-----------RHC-------EAALGNETVCT---LWQEGR--------CFRRVCRFRHMEIDK------KRSEIPCYWENQPTGCQKLNC....................................................................... 80
5 -8.290[R] KOG3002 Zn finger protein  ali follow..  17  14...............................................SNSTGVDYEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYELLECPVCTNLMYPPIHQCPNG------HTLC--SSCKLRVQNTCPT---CRYELGNIRCLALEKVAESLEVP--CRYQNLGCQDIFPYYS----LKHEQHCRFRSCPYAGSECS................................................................................................... 153
6 -7.800[R] COG1913 Predicted Zn-dependent proteases  ali follow..  21  131.............ALKEAMHELGHVFGLEH---------CPNPKCVMHFSNSIIKSWMYCEKCLRKLEKNLTRS.................................................................................................................................................................................................................................. 186
7 -7.740[R] COG5084 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins  ali follow..  17  200...............................................................................................VGNSPSAVYC-CGKGAACRHEPTRKTICPKFLNGRCNKAEDCN------SHELDPRRIPACRLLGKCNNPN--CRHIHYSENAPICFE-YGFCELGSCKQHILQCTD-YAMFGSCNNPQC..................................................................................... 328
8 -7.590[T] KOG1701 Focal adhesion adaptor protein Paxillin and related LIM proteins  ali follow..  19  414...........................................................................GRC-------------ARCGENVVGEGTGCDCFTCIICNNKLRGQPFYAVEKKAYCEP---CNVCSKPIMERILRATGKHCFTCVMCHGGLIHCIEDFHKKFAPRCSV----CKEPIMPAPGQEETVRIVALDRDFHVHCYR---------EDCGGLSEGDNQGCYPLD---GHILCKT.............................................. 595
9 -7.380[R] KOG3511 Sortilin and related receptors  ali follow..  15  610...........................................................RNCEEKDYTIWLEDYEDGCILGYKEQLRLRKSSVCQNG-TKQPSICLCSLED----------LCDFGYYRPENDSKCVEQPELKGH-----------DLEFCLYGREEHLTTNGYRKPGDKCQGGVN---VREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIV.............................................................. 778
10 -7.350[OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger  ali follow..  19  58...................................................................................................EAAPKCNCSQKKDCPHIICS--YCGATDDRHCPKAIQCSKCDEVHYRSQCPHKWKKCTL---CKSKKERCPSDNEKAKPKVLPFHTIYCYN--CGGKGDDCKEKRSSRVPNEDGSAFTGSNLS.............................................................................. 199

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.