current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00248 gi|162576253|dbj|BAAV01029229.1|2.0 TMP00024;, from HGM_OVER

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst LSKEVNQEERAPRTVADVKEMLTKHSNGEIQRTIQNCITILQNDHVLADAIRLNLLSERIDIVKPVGWPRSGKTLNDTDMKYILRRMEKYGISSEKKIESAIRIVGNENPYHPIRDYLNGLLast
1 -6.090IDP91498 translocation protein in type III secretion [Vibrio parahaemolyticus RIMD 2210633] VP1675 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  221VKREYKEMEGSPEIKSKRRQLHQELQASNQRENVKRSNVLVTNPTHIAVGLYYKKGETPLPVITLMETDAMAKRMIAIAREEGVPVMQKVPLARALYADGNVDQYIPSELIEATAEVLRWL 341
2 -5.860IDP05132 gene: flhB; bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium difficile 630] CD0262 [Peptoclostridium difficile 630]  ali follow..  15  472VKDEYKNSEGDPEVKAKIKQKQRQISSQRTMQAVPSATVIVTNPTHLSIAVRYEKGKDQAPVVVAKGADYLAFKIREIAKGNDIPIIENKPIARLLYKQVEIDQEIPEDMYQAFAEILVAV 592
3 -5.800IDP04703 putative type III secretion apparatus protein [Yersinia pestis CO92] YPO0273 [Yersinia pestis CO92]  ali follow..  10  221VKREYKDSNGDPHIKQKRRQLQHEVQSGSFATNVRRSTAVVRNPTHFAVCLIYHPEETPLPIVIEKGHDEQAALIVSLAEQSGIPVVENIALARALHRDVACGDTIPEQFFEPVAALLRMA 341
4 -5.750IDP91183 gene: yscU; type III secretion system protein [Chlamydia trachomatis D/UW-3/CX] CT091 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  14  221VKQEFKDTEGNPEIKGRRRQIAQEIAYEDTSSQIKHASAVVSNPKDIAVAIGYMPEKYKAPWIIAMGVNLRAKRIIAEAEKYGVPIMRNVPLAHQLLDEGKELKFIPETTYEAVGEILLYI 341
5 -4.760IDP91857 MutR [Streptococcus pneumoniae P1031] SPP_0211 [Streptococcus pneumoniae P1031]  ali follow..  11  14LRLARKLKQSDVACAGLTASQLSKFELGQSMLSADKLILAIQG------NMNFDEFGHKLNNYQESPHMRIGRRVVDCDIAALEQLLEEVDQEQMAQTYRRLNAIVTEEDSEFLTTYLYAI 147
6 -4.690IDP91472 putative type III secretion system EscU protein [Vibrio parahaemolyticus RIMD 2210633] VPA1354 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  11  220MKNELKETEGSPEIKSE-RKRQMREFAETPITKGRQPTFALANPTHILVPVCYDPKIERRPVVLKI---------TESLALEERKRLEAMGIIEHIPLARAMYSKMKKEFFNDVALIISYL 340
7 -4.570IDP91856 MutR [Streptococcus pneumoniae Hungary19A-6] SPH_0253 [Streptococcus pneumoniae Hungary19A-6]  ali follow..  10  14LRLARKLKQSDVACAGLTASQLSKFELGQSMLSADKLILAIQG------NVTFDEFGHKLNNYQESPHMRIGRKVVNQDIAALEQLLEEVDQEQMAQTYRRLNAIVAEEDSEFLTTYLYAI 147
8 -4.530IDP91854 transcriptional regulator [Streptococcus pneumoniae TIGR4] SP_0141 [Streptococcus pneumoniae TIGR4]  ali follow..  10  14LRLARKLKQSDVACEGLTASQLSKFELGQSMLSADKLILAIQG------NVTFDEFGHKLNNYQESPHMRIGRKVVNQDIAALEQLLEEVDQEQMAQTYRRLNAIVAEEDSEFLTTYLYAI 147
9 -4.490IDP04040 gene: cotJC; spore coat protein CotJC [Clostridium perfringens ATCC 13124] CPF_1068 [Clostridium perfringens ATCC 13124]  ali follow..  11  134............................................................................AAEQKARATYQWLINLTDDQDIKEILRFLREREIVH-FGEALMDV 180
10 -4.420IDP91839 gene: mutR; positive transcriptional regulator [Streptococcus pyogenes NZ131] Spy49_0415 [Streptococcus pyogenes NZ131]  ali follow..  10  12LRKGKQVSISFLADEYLSKSQISRFERGESEITCSRLLNLLDK------NITIDEFHSKTHTHFFTLLSQARKCYAEKNVVKLTKLLKDYAHKDYERTMIKAILFSSQEELTRLTDYLFKV 137

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 9 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.