current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00106 gi|162841414|dbj|BABA01003295.1|1.0 TMP01000;, from HGM_OVER

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst LEDGDFVKLSNLTIGYTLPIRNNKYMKSLRVYVSGNNLFCITGYSGLDPELDISNVQAPGVEYRDTYPTTRSFTFGVNIGFLast
1 -7.710sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 (Range: 2401-2700)  ali follow..  14  155LTRGSQYRVESMMLNYIPVTPSVQQRSQMRAPQCVPLI--------MEPESRFYSNSVLVLDFQSLYP---SIVIAYNYCF 230
2 -7.280sp|O00418|EF2K_HUMAN Eukaryotic elongation factor 2 kinase OS=Homo sapiens GN=EEF2K PE=1 SV=2 (Range: 1-300)  ali follow..  15  228LEEGKYIKYNS-NSGFVRDDNIRLTPQAFSTFERSGHQLIVVDIQGVDPQIHTETGTDFG..................... 296
3 -6.930sp|Q9BX84|TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens GN=TRPM6 PE=1 SV=2 (Range: 1651-1950)  ali follow..  20  225IETGEFRKYNN-NNGDEITPTNTLEELMLAFYEYTRGELLVLDLQGVDPSVIKPEVKQSRGMVFG................ 300
4 -6.620sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens GN=POLA1 PE=1 SV=2 (Range: 601-900)  ali follow..  19  180LMGGRSERNEFLLLNYIVPDKQIFRKPQQKLGDEDEEI---AAYAGLDPKVGFYDKFILLLDFNSLYP---SIIQEFNICF 276
5 -6.400sp|Q96L96|ALPK3_HUMAN Alpha-protein kinase 3 OS=Homo sapiens GN=ALPK3 PE=2 SV=2 (Range: 1501-1800)  ali follow..  14  221LEGKPLESYCS-REWGCAEAPTASGSSEAMLYQWTNGSFLVTDLAGVDVQIATKLRGYQGL.................... 297
6 -6.230sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 (Range: 451-750)  ali follow..  14  84....EMARVTGVPLSYLLSRGQQVKVVSQLLRQAMHEGLLMEDYTGIEPLKGYYDVPIATLDFSSLYP---SIMMAHNLCY 168
7 -6.010sp|P43405|KSYK_HUMAN Tyrosine-protein kinase SYK OS=Homo sapiens GN=SYK PE=1 SV=1 (Range: 1-300)  ali follow..  16  188.TNGKFLIRARDNNGYALCLLHEGKVLHYRIDKDKTGKLSIPEFDTLWQLVEHYSYKADGLLRVLTVPCQKI......... 262
8 -5.980sp|O00418|EF2K_HUMAN Eukaryotic elongation factor 2 kinase OS=Homo sapiens GN=EEF2K PE=1 SV=2 (Range: 151-450)  ali follow..  13  78LEEGKYIKYNS-NSGFVRDDNIRLTPQAFSTFERSGHQLIVVDIQGVDPQIHTETGTDFGDGNLGV............... 152
9 -5.950sp|P20936|RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens GN=RASA1 PE=1 SV=1 (Range: 151-450)  ali follow..  22  220.QVCSFLRPSDNTPGYSLYFRTNENIQRFKICPTPNNQFMMGGYNSIGDIIDHYRKEQIVEGYYLKEPVPMQ......... 294
10 -5.910sp|Q8N8S7|ENAH_HUMAN Protein enabled homolog OS=Homo sapiens GN=ENAH PE=1 SV=2  ali follow..  20  1MSEQSICQARAAVMVYDVPAGGSTGFSRVHIY-TGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWVYGLNFG. 92

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 9 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.