current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00248 gi|162576253|dbj|BAAV01029229.1|2.0 TMP00024;, from HGM_OVER

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst LSKEVNQEERAPRTVADVKEMLTKHSNGEIQRTIQNCITILQNDHVLADAIRLNLLSERIDIVKPVGWPRSGKTLNDTDMKYILRRMEKYGISSEKKIESAIRIVGNENPYHPIRDYLNGLLast
1 -7.940sp|O94812|BAIP3_HUMAN BAI1-associated protein 3 OS=Homo sapiens GN=BAIAP3 PE=1 SV=2 (Range: 601-900)  ali follow..  10  206................................VLNNVELVRKAAGQALKGLAWPEGATGPEGVLPRPLLSCTQALDDDLQREAHTVTAHLTSKMVGDIRKYVQHISLDEAVAPLMKYLDE. 300
2 -7.710sp|Q9Y6J6|KCNE2_HUMAN Potassium voltage-gated channel subfamily E member 2 OS=Homo sapiens GN=KCNE2 PE=1 SV=1  ali follow..  1..............................MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVE. 90
3 -6.840sp|Q6ZTW0|TPGS1_HUMAN Tubulin polyglutamylase complex subunit 1 OS=Homo sapiens GN=C19orf20 PE=2 SV=2  ali follow..  15  28...........................................................................AAGAAESEEDFLRQVGV--TEMLRAALLKVLEARPEEPIAHYFENM 74
4 -6.630sp|A2RUB6|CCD66_HUMAN Coiled-coil domain-containing protein 66 OS=Homo sapiens GN=CCDC66 PE=1 SV=4 (Range: 151-450)  ali follow..  14  168...EHPFSAVKQELQRKWIEELNKQIEDDRQRKIEEKIIYSKGEEHDRWAMHFDSLKSYPGSQSQLFSQSTHKQPEYFCVSPDTQELADVSSVCTPTTGSQVEPSEEEHIAKPIKDFLRSM 295
5 -6.190sp|Q9BZH6|WDR11_HUMAN WD repeat-containing protein 11 OS=Homo sapiens GN=WDR11 PE=1 SV=1 (Range: 1051-1224)  ali follow..  45LAKVRLNPEECADVLRRWVDHLCSPQVNQKSKALLVLLSLGCFFSVAETLHSMRYFDRAALFVGAFEVTEDTEKLITAIYADYARSLKNLGFKQGGAAGKDLLNELESPKEEPIEE..... 174
6 -6.180sp|P15382|KCNE1_HUMAN Potassium voltage-gated channel subfamily E member 1 OS=Homo sapiens GN=KCNE1 PE=1 SV=1  ali follow..  14  1......................................MILSNTTAVTPFL-WQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIES. 84
7 -6.120sp|Q9C005|DPY30_HUMAN Protein dpy-30 homolog OS=Homo sapiens GN=DPY30 PE=1 SV=1  ali follow..  16  47............................................................................DLQSLPTRAYLDQTVVP---ILLQGLAVLAKERPPNPIESYL... 88
8 -5.840sp|Q03167|TGBR3_HUMAN(removed signalp:1-20) Transforming growth factor beta receptor type 3 OS=Homo sapiens GN=TGFBR3 PE=1 SV=3 (Range: 151-450)  ali follow..  16  83....................TIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIR--------DIPSTQGNLVKWALDNGYSPITSYTM.. 174
9 -5.760sp|Q96M32|KAD7_HUMAN Putative adenylate kinase 7 OS=Homo sapiens GN=AK7 PE=2 SV=3 (Range: 451-723)  ali follow..  16  216....................................................................KREERELLEAQSIPLRNYLMTYVMP---TLIQGLNECCNVRPEDPV-DFLAE. 263
10 -5.540sp|Q5BJE1|CR034_HUMAN Uncharacterized protein C18orf34 OS=Homo sapiens GN=C18orf34 PE=1 SV=3 (Range: 601-867)  ali follow..  11  113YMQEKKDCEERIFEEDQRFRVLLAVRQKTLQDTQKIIADSLEENLRLAQEYQFNIYDKQLSLDTSIRDKKQLCQLQRRMHTLWQEHFKLVVLFSQMRLAN-FQTDSQESLMQHILGFFQTL 258

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 9 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.