current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00857 gi|162620543|dbj|BAAW01002606.1|2.0 TMP01139;, from HGM_OVER

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MLNFHSKKVMCIQQEIYARMIMYNFVQMITSHVVIVKKQRKHTYKANFSVATHMCRLFYREKTTSPNLETIIAKNLIPIRPDRHRERNLKVKTFHGFLYRVALast
1 -7.100sp|Q9H3C7|GGNB2_HUMAN Gametogenetin-binding protein 2 OS=Homo sapiens GN=GGNBP2 PE=1 SV=1  ali   137....HAKTIDIAQEEVLTCL----HLYERLHRIWQKLRAEEQTWQMLFYLGVDALRKSFEMTVEKVSRLEQLCEEFSEEERVRELKQEKKRQKRKNRRKNKC 235
2 -5.990sp|O95180|CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens GN=CACNA1H PE=1 SV=4  ali   10  231.NRFRVSCQKVITHKMFDHVV---LVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVA............................. 299
3 -5.970sp|P57678|GEMI4_HUMAN Component of gems 4 OS=Homo sapiens GN=GEMIN4 PE=1 SV=1  ali   86ALHIMAMLHPEVCEPLY--VLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSS............................ 157
4 -5.640sp|Q3MII6|TBC25_HUMAN TBC1 domain family member 25 OS=Homo sapiens GN=TBC1D25 PE=1 SV=2  ali   225...YHGGVEPSLRKVVWRYLLNVYPDGLTGRERMDYMKRKSREYE-----QLKSEWAQRANPEDLEFIRSTVLKDVL--RTDRAHP................ 300
5 -5.600sp|Q8N2C7|UNC80_HUMAN Protein unc-80 homolog OS=Homo sapiens GN=UNC80 PE=2 SV=2  ali   16...LPSQSEPNVLDDSQGLAAEGSLSRVASIQSEPGQQNLLVQQPLGRKRGLRQLRRPLLSRQKTQT-------------RNRQGARLSTTRRSIQPKTKPS 103
6 -5.570sp|Q9NQS1|AVEN_HUMAN Cell death regulator Aven OS=Homo sapiens GN=AVEN PE=1 SV=1  ali follow..  30  14...............................................................................RPGRGRPGGDRHSERPGAAAAVA 36
7 -5.420sp|P35913|PDE6B_HUMAN Rod cGMP-specific 3`,5`-cyclic phosphodiesterase subunit beta OS=Homo sapiens GN=PDE6B PE=1 SV=2  ali   8ARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEESTALLELVQDMQESINMERVVFKVLRRLCTL....................... 86
8 -5.420sp|Q01955|CO4A3_HUMAN(removed signalp:1-28) Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3  ali   12  205FIMFTSAGSEGTGQAL-SCLEEFRASPFLECHGRGNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH................... 292
9 -5.390sp|Q9NQA5|TRPV5_HUMAN Transient receptor potential cation channel subfamily V member 5 OS=Homo sapiens GN=TRPV5 PE=2 SV=2  ali   18  114...............IIATLLMLNLFIAMMGDTHWRAQERDELWRAQVVATTVMLERKL........................................... 158
10 -5.350sp|Q6P4F7|RHGBA_HUMAN(removed signalp:1-17) Rho GTPase-activating protein 11A OS=Homo sapiens GN=ARHGAP11A PE=1 SV=2  ali   21...FSSKKRKSIKHNFNFELLPSNLFNSSSTPVSVHIDTSSEGSSQSSLSPVLIGGNHLITAGVPRRSKRIAGKKVCRVESGKASPKISHKEKRRSLRLKFN 123

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.