current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00150 gi|162733542|dbj|BAAZ01030454.1|1.0 TMP01074;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst LLGITNVPDKKNYAIDELGLSAQAARNLYAGKANAQVVNYLLESPRFLDLTYILEQYFNDTVAAGYAAQNQLYTTISSLTRKTVKTEAGEQAARDIAHLRTSVYQADLVTIENQFMLAVKEVKKEIGNDFAAMQSMTAEAAKRMFTEVAKGQDMTNPTITPEQVSDLIYRSVAGLDGCHRDALNTLGQALTGFFQNHLRAAQYRRKAMKRQDNEQLCALAQKGTQSSLast
1 -106.000HGC00150 gi|162733542|dbj|BAAZ01030454.1|1.0 TMP01074;  ali  100  1LLGITNVPDKKNYAIDELGLSAQAARNLYAGKANAQVVNYLLESPRFLDLTYILEQYFNDTVAAGYAAQNQLYTTISSLTRKTVKTEAGEQAARDIAHLRTSVYQADLVTIENQFMLAVKEVKKEIGNDFAAMQSMTAEAAKRMFTEVAKGQDMTNPTITPEQVSDLIYRSVAGLDGCHRDALNTLGQALTGFFQNHLRAAQYRRKAMKRQDNEQLCALAQKGTQSS 227
2 -3.720PB034679 gi|150005530|ref|YP_001300274.1| hypothetical protein BVU_3014 [Bacteroides vulgatus ATCC 8482]gi|149933954|gb|ABR40652.1| conserved hypothetical protein [Bacteroides vulgatus ATCC 8482]  ali follow..  10  34.........RYSDALALLKEDENRLKILIEKEI-------IHQNGNFVELDARFLDFFELLLEANTATVEENIEYLHELMDYYLKEKIQSRKESYVRNIKIT-----FQKLARVTIRNIINLQHNIDNAFKHEPTAKLQNLDKKRINIQRLIDSTEHLILHEERDFFRQATDEELTRILLELRQELQLSAHSLIRAQQDIINYLNQIKNQVI-EKIRKVKYLQDQ.. 247
3 -3.160PB003142 Q8DVS6_STRMU/1-162 PB003142; Pfam-B_3142;  ali follow..  116.......................................................................................................................................................................................TKAQAEMQKLHEALKKEKKSQSKEKRQALKQYKYQLKQEKRHQK 159
4 -2.540HGC00803 gi|163280588|dbj|BABD01030100.1|2.0 TMP01051;  ali follow..  1...................LNEKGAIPMKAFDPNYKLLDEMYQDDYYP---------------------AFLVDKVKDELQKVIDLLESG-----------ETDTEVIQETLDEAVCGINDLQEEFDENDSEIETVARDCIGVTVAYILE............................................................................. 99
5 -2.440PB019388 gi|83589066|ref|YP_429075.1| Radical SAM [Moorella thermoacetica ATCC 39073]gi|83571980|gb|ABC18532.1| Radical SAM [Moorella thermoacetica ATCC 39073]  ali follow..  10  17...VLASSAITYEEMLRLHAIEGLLKYYGNSHLADHAFAYLAATAFDGSYFAIYEALAAWWEARGLLRRGHSQRDLFNHLASFAIHLARGIATRVTVPPLPG............................................................................................................................. 115
6 -2.260PB008806 Q5L9W8_BACFN/1-127 PB008806; Pfam-B_8806;  ali follow..  11..............PSFISYGNLQTATMIIGT----------------PLSIAESYV-HKNMGEILQQTMSITQIRI---------KPTDKNKLFLNINHINVSDWFKEQLNKLNQSVRMKQRQKIVRVQSSNDSILLDFSKKV................................................................................... 114
7 -2.260PB019278 gi|154508461|ref|ZP_02044103.1| hypothetical protein ACTODO_00960 [Actinomyces odontolyticus ATCC 17982]gi|153798095|gb|EDN80515.1| hypothetical protein ACTODO_00960 [Actinomyces odontolyticus ATCC 17982]  ali follow..  1...........................................................................................................MDTIDNFLDAMFAPYPA---------STRLTDAKVELRAMMDAYADAIASGMTHNEAVGRVITDFGNLQEIAPVLGIADDLTAAEKAPQPEAAPAPAGTEGVGAPSRPRVTLPEAQE... 109
8 -2.180HGC00311 gi|163635536|dbj|BABG01000737.1|2.0 TMP00178;  ali follow..  12  16........................................................................................................................................................................................QVETQLAQEQHKLKRLENRKKYLEKGERQKRTHRLCNLG.... 54
9 -2.080PB014998 gi|86133284|ref|ZP_01051866.1| hypothetical protein MED152_01230 [Tenacibaculum sp. MED152]gi|85820147|gb|EAQ41294.1| hypothetical protein MED152_01230 [Polaribacter dokdonensis MED152]  ali follow..  1..............MSILKITEELQNLGNAGKDNQRVANIVLENKEL----------FEPLLEVTFQVDEPISVKAAWVLEWICTHHQLSWMIPHLTFFTENLKNLTFDSAIRPCAKICEHLKRDNEFKSKLKNEHIQEIIETGFDWLITPQKIAVRAYTMNTLYLF-------------LENDWVHPELKHLIETKIIHESKG-----KARGKHILNLIEKHQKS. 193
10 -2.030PB007740 Q89YT2_BACTN/1-193 PB007740; Pfam-B_7740;  ali follow..  32....................................................................................KQRPTPEQMMQMQTNQMVRALMLDDATAAKFTPIYEKYLKELRECRMMNFKPRARKDAAQGTEANTAKETPKPVMTDAEIAKMLKDQF----AQSRKMLDIREKYYNEFSKILSQKQIMKIYQQEKSNMNKFKEFDRRKGQKP 171

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 8 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.