current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00311 gi|163635536|dbj|BABG01000737.1|2.0 TMP00178;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MAKPKNLEQLRAEKEQVETQLAQEQHKLKRLENRKKYLEKGERQKRTHRLCNLGGTIESLAPEFKDLTRTEMTELMEYIFSLPEVQRAVRHMAITHINQASRGKEQKADGNIPLHRHPDQTQLast
1 -89.600HGC00311 gi|163635536|dbj|BABG01000737.1|2.0 TMP00178;  ali  100  1MAKPKNLEQLRAEKEQVETQLAQEQHKLKRLENRKKYLEKGERQKRTHRLCNLGGTIESLAPEFKDLTRTEMTELMEYIFSLPEVQRAVRHMAITHINQASRGKEQKADGNIPLHRHPDQTQ 122
2 -10.300HGC00509 gi|162658693|dbj|BAAX01000912.1|3.0 TMP00561;  ali follow..  21  33MAKSTKEERIRALEKKEQESIEATKKLIAQRKELEKRKKAEESKKRTHRLCQIGGAVESVL---CPIEEEDLPKLIGFLKRQETNGKFFSKAMQK........................... 127
3 -5.600PB003142 Q8DVS6_STRMU/1-162 PB003142; Pfam-B_3142;  ali follow..  13  116...TKAQAEMQKLHEALKKEKKSQSKEKRQALKQYKYQLKQEKRHQKRQ......................................................................... 161
4 -3.730PB006154 _JGI.0331794_ 2004021056 [Human Gut Community Subject 7]  ali follow..  20  110..KAEKEVEEIVRLSQKEKSGEKNIHNAGGVKQSRPDGSKGNRKKR............................................................................ 153
5 -3.180HGC01215 gi|162843249|dbj|BABA01001460.1|3.0 TMP01713;  ali follow..  11  5.................................................FCVEGFSVDVFIVHIREI----FPVLFFCHFSVSDTFANKAASGGNVVSENTIAVHEQTDAYIAMPQLPYLPD 74
6 -2.870PB031792 gi|154174791|ref|YP_001409041.1| flavodoxin family protein [Campylobacter curvus 525.92]gi|112804021|gb|EAU01365.1| flavodoxin family protein [Campylobacter curvus 525.92]  ali follow..  15  4.........................DKGGPEAHFKRYIKEHVKGKKTGLFITLGAHGESMLKVGRELLNEGGNEILAEFICQGAIDPKVIEEMKEMAAKMGDKAPERQATWKQASTHPDEND 110
7 -2.660PB030138 Q7MX14_PORGI/1-113 PB030138; Pfam-B_30138;  ali follow..  11  9QRKPRSFD---QRRDELEKRIERIRREVEQEEQAELDGQSSSHDYSGYRPRIRGTFVEG............................................................... 71
8 -2.560PB071107 _Gut.Meta.Jp.0066071_ gi|162701604|dbj|BAAY01026246.1||2 (+ 344:749~0 complete)  ali follow..  15  2..........................................KRFASHFLFTEEGSVVRIFPLTEEIENVEWLP................................................ 46
9 -2.370HGC00928 gi|162868028|dbj|BABB01001979.1|3.0 TMP01255;  ali follow..  7VPMARTATEKLEMRGQSVTVENIGKTVTDGFEKVSNNVNDFISSDKPRNFFQKVLVIGFILKFFIILAGIFLLPPLVLVV.......................................... 91
10 -2.330PB005684 gi|160884252|ref|ZP_02065255.1| hypothetical protein BACOVA_02230 [Bacteroides ovatus ATCC 8483]gi|156109991|gb|EDO11736.1| hypothetical protein BACOVA_02230 [Bacteroides ovatus ATCC 8483]  ali follow..  10  137.......DEIRKEVTIQMKAYKKEKAEYDAMGKERTKKEAPQMPPNRMFLISGNNTGTGIL---QNIMDSD-----TGLICEAEADTLSTAIGSDHGHWSDTLRKAFDHDRLSYNRRTDQE. 243

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 8 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.