current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00374 gi|162831834|dbj|BABA01012875.1|1.0 TMP00304;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst VKVEVHYFDELLERIRDIRASEKRVYRKVKEIFALSVDYDSKSQVAQSFFKSVQNKLEYAATGHTAPELIAKRADASKDNMGLTSFKGVKVRRGDVTVAKNYMTHEEISTLNLIVNMYLDYAELQAKGHIPMHMADWESKLGDFLRFNGREVLENFGTVKREVAEKLALEQYEQYDTHRRALEAADDVDELTADVKRLKRLast
1 -106.000HGC00374 gi|162831834|dbj|BABA01012875.1|1.0 TMP00304;  ali  100  1VKVEVHYFDELLERIRDIRASEKRVYRKVKEIFALSVDYDSKSQVAQSFFKSVQNKLEYAATGHTAPELIAKRADASKDNMGLTSFKGVKVRRGDVTVAKNYMTHEEISTLNLIVNMYLDYAELQAKGHIPMHMADWESKLGDFLRFNGREVLENFGTVKREVAEKLALEQYEQYDTHRRALEAADDVDELTADVKRLKR 200
2 -3.730PB011051 Q8A0P0_BACTN/1-227 PB011051; Pfam-B_11051;  ali follow..  16  39........QAVIARLIDIRKAQQEYRSLHHGMYTEHFD.................................................................................................................................................................. 68
3 -3.510HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234;  ali follow..  21  31....EGYFENLTSEVGKLPEKEG................................................................................................................................................................................. 50
4 -2.980PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali follow..  31........KEFIGRTAKSLSLALAIFSGC--SVLPAWSQEIVAGELERCFLAMPESVLPIVTMEERNDLCRRAGHLSGFTHTASL-ESSLGGTVTFLLNRNFIGEVFMRILSSVICVVTTVLHPVADSRIDFYTTEWKP............................................................. 173
5 -2.620HGC00921 gi|162841401|dbj|BABA01003308.1|3.0 TMP01242;  ali follow..  49.......FETAHSYYVHCYGEQSRNSKKHQANVKTARLYISHFIQVLNL-AVIRMEIKESHKALYGLPVDNFSVPDLSSEASLAEWGQKIIEGERKRTSQIPIYNPTIAKVKVHYDIFMEGYEKQLTNRSLEQLASMRVQADRLILDIWNQVEAKFQDVSPNEKRLEKCRDY-IIIIGPEKNRIRRFFKICLSI-KSLQK 254
6 -2.470PB002589 gi|91201099|emb|CAJ74158.1| hypothetical protein [Candidatus Kuenenia stuttgartiensis]  ali follow..  41...GPDFKHAE------FFLEGKGLIRGSVEIHVFASDWIHHKHENQKTYDAV---LHVVMWNDLKGRCVKNFSGKVIPQITLSLYLEAELDEIIETIDVGSYIGNK-NLEMRKQKITQQWIGGFLDYAGDERILQKAKKYEKWIENKPFEIMESLGYKNNKKPFLMLASLVT-AETIQSFVPEYTPAQEKKIIAQSL.. 238
7 -2.310PB012386 gi|82541244|ref|XP_724876.1| blood-stage membrane protein Ag-1 [Plasmodium yoelii yoelii str. 17XNL]gi|23479680|gb|EAA16441.1| blood-stage membrane protein Ag-1 [Plasmodium yoelii yoelii]  ali follow..  32.......VQDISEDLIKIELNQNVSINKIFNILKASQASENTQNLRKK----------------------------HAPIKVLINRKNFNLYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXNFDTNESDKIKGDKNYYNSLENFEGYSYKKIYDNLREATKHENSHFQHDEEILFHSSDANTNKESLYELTENELKNIKK 205
8 -2.270PB000119 Q6KIT1_MYCMO/1-381 PB000119; Pfam-B_119;  ali follow..  13  217....NSTFLNLAQRINTIRPNPNPNPNEIFNFDLNNLPIENGLLTVEAIW--LQSKMELT---DTATVIIINNTAYVNINKNSVKHNNFAVNYLKSEENNWYLTGRDFPLLGLFVEKFF--------KDDVEVFSPKIPALYFVVNNSTKNIFSSVGISSLSTNNPKLIFTFT........................... 375
9 -2.150PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF  ali follow..  130.................................................................................................................FIGYFREAMYKRHKNSSTSILVNWKRAMDFLKMYAGENL-------PFFKIDNAFAEEYKRF......................... 184
10 -2.070PB013946 A7ABR4_9PORP/121-442 PB013946; Pfam-B_13946;  ali follow..  10  143.....DYLRMLKKLGQDLRNPKNICPEDFMDNATRKIEAIHEKERAAEQRRWEIERREREQQRQLQRKKDAEDFIANKSKFFGLVITDEEIIVKVLESIDEYY--NEGKTQGICVFGSGYYKKADTL----LSARIGDEIIETVVDLRTLEVVQCHGKHNQDTEYHERIIDLNKNANLIRERMKA............... 322

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 9 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.