current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00593 gi|162858151|dbj|BABB01011554.1|1.0 TMP00709;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MDMTDNNDDVLVKKFFSENRIDVPDDGFSRRVMRRLPDRTRRISRLWTAVCVVIGLLIFFRNKGFSVLVSCFDGIFSDVLARHEQLNNPHLLLPVAMVLILLWGVGFAVRERLast
1 -60.400HGC00593 gi|162858151|dbj|BABB01011554.1|1.0 TMP00709;  ali  100  1MDMTDNNDDVLVKKFFSENRIDVPDDGFSRRVMRRLPDRTRRISRLWTAVCVVIGLLIFFRNKGFSVLVSCFDGIFSDVLARHEQLNNPHLLLPVAMVLILLWGVGFAVRER 112
2 -8.160PB001708 Q3IRP6_NATPD/1-505 PB001708; Pfam-B_1708;  ali follow..  20  2........................NEGIPEQLIRRLSDASR----------LVPLALLAVVAAVIYVWRPLFHGLIYRVAYSPSLLILVGTTVVAGIALVFWPRMGEDPLES 79
3 -7.180HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234;  ali follow..  19  1MSKKKRGEERMLKKVGKKNSFKVPEGYFTSEVMGKLPEKEGMWIRMKPLLYMAAMFIGAALI.................................................. 81
4 -4.190PB021133 Q64YN4_BACFR/1-310 PB021133; Pfam-B_21133;  ali follow..  11  23ANYLEHEDLERMEKFFNLTENNIY----KSKVIKDIDSNIGQLLK................................................................... 69
5 -4.180PB011130 gi|88806557|ref|ZP_01122074.1| hypothetical protein RB2501_00756 [Robiginitalea biformata HTCC2501]gi|88783389|gb|EAR14561.1| hypothetical protein RB2501_00756 [Robiginitalea biformata HTCC2501]  ali follow..  10  16...IDENAYQKLLRYLEAVKRSFAGTAGSDEIIADIEARIAEL..................................................................... 55
6 -3.970PB002104 Q72PH8_LEPIC/1-220 PB002104; Pfam-B_2104;  ali follow..  14  1...........MHNF----KEKIQ---FSKRSRSCPFMQQNKFRKA-AILMPMILVVSFGNCFGKFAIVKKVYEVNDGFNIGSGLLAKFIKTLVMYFPFSILYFVGFFFD.. 94
7 -3.700PB007147 Q11UU2_CYTH3/1-245 PB007147; Pfam-B_7147;  ali follow..  10  3LIKGEPGKGIVLKEYIVDWILTIEDREQRTRYANTCVELMRQLNKLWDHLFIMSNFKLDV.................................................... 79
8 -3.250PB007740 Q89YT2_BACTN/1-193 PB007740; Pfam-B_7740;  ali follow..  121...QSRKMLDIREKYYNEFSKILSEKSNMNKFRKEFDRRKGQ...................................................................... 169
9 -3.230PB005684 gi|160884252|ref|ZP_02065255.1| hypothetical protein BACOVA_02230 [Bacteroides ovatus ATCC 8483]gi|156109991|gb|EDO11736.1| hypothetical protein BACOVA_02230 [Bacteroides ovatus ATCC 8483]  ali follow..  14  252LSVLISGTPSQVQTFIPT-----AEDGSYSRQLYYYMCGI........................................................................ 286
10 -3.120HGC00962 gi|162759780|dbj|BAAZ01005693.1|3.0 TMP01305;  ali follow..  67.EFAEKALRQYCGRLHAERTGAYLPRALQGVLEGTLGVFGERLGRLLLKLAVEHNMTNHLLGGDMDMTRDEYSKMRGSSVREVSATH......................... 152

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.