current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00857 gi|162620543|dbj|BAAW01002606.1|2.0 TMP01139;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MLNFHSKKVMCIQQEIYARMIMYNFVQMITSHVVIVKKQRKHTYKANFSVATHMCRLFYREKTTSPNLETIIAKNLIPIRPDRHRERNLKVKTFHGFLYRVALast
1 -73.600HGC00857 gi|162620543|dbj|BAAW01002606.1|2.0 TMP01139;  ali  100  1MLNFHSKKVMCIQQEIYARMIMYNFVQMITSHVVIVKKQRKHTYKANFSVATHMCRLFYREKTTSPNLETIIAKNLIPIRPDRHRERNLKVKTFHGFLYRVA 102
2 -3.320PB012771 _Gut.Meta.Jp.0094636_ gi|162817068|dbj|BABA01027641.1||1 (+ 249:636~0 complete)  ali follow..  18  111MEMICGRVEEVVCEEI...................................................................................... 126
3 -3.320PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  13  16..NMDTQKKHNLSGTIILVSCFLLLAGACDNSDRIETETQANGVLLNFNASTI................................................. 66
4 -2.890PB008694 Q9F6U1_BACTN/1-190 PB008694; Pfam-B_8694;  ali follow..  17  1.......................................................................MLRRSVPKSIWRTPPR--KRRKWRFTVWRRS 29
5 -2.540PB011023 A7V2G7_BACUN/1-167 PB011023; Pfam-B_11023;  ali follow..  10  1MNILNNKNKRTSIFKALALCLFAAVSFTFVSCDDDMDIQQSYPFTVE....................................................... 47
6 -2.510PB062763 Q9F6U5_BACTN/1-245 PB062763; Pfam-B_62763;  ali follow..  157.............EDI-----AVRTIKKDSPSEAEMRHAGKVMTELDGTELYSRITERLTDEPMSERLAKAMAVFVDTVNTTVAQPKTKVFVVLD....... 235
7 -2.260HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  18MVGCGKQVPENIPDRMENILYDYHLSISMGNNLSYSDNYQKEKHHITEAEFDSSMVWYTRHTEELASLYKKLGERFRSEKKHMQELLALRENKPA....... 122
8 -2.210PB003564 gi|46242789|gb|AAS83494.1| TraD [Bacteroides fragilis]  ali follow..  157.............EDI-----AVHTIWKESPSDEEMRHAGKVMTELDGTELFTRITERLTDEAMSERLAKAMAVFV.......................... 216
9 -2.000PB003142 Q8DVS6_STRMU/1-162 PB003142; Pfam-B_3142;  ali follow..  61.............SDIWNFIAKK-IKKYDHIKTSSHADSIPQPKKMNPKRMQRVLNKSKKQSAVSTKAQAEMQKLHEALKKEKKSQSKEKRQALKQYKYQLK 152
10 -1.880PB001823 Q5L7Q9_BACFN/1-326 PB001823; Pfam-B_1823;  ali follow..  102....AKVWQAIMFEDTQNGDYDYNLIIHVKNTASNHAYQHPTETWQTIEIQPIAL............................................... 153

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 8 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.