current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MSKKKRGEERMKEEDNILKKVGKKNSFKVPEGYFENLTSEVMGKLPEKEGPAFEEVKQPMMWIRMKPLLYMAAMFIGAALIIRVASSNHQPTTAGDHLTANEAATEVVSDEYIDVALDRSMLDDYSLSVYLSDATAELast
1 -63.600HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234;  ali  100  1MSKKKRGEERMKEEDNILKKVGKKNSFKVPEGYFENLTSEVMGKLPEKEGPAFEEVKQPMMWIRMKPLLYMAAMFIGAALIIRVASSNHQPTTAGDHLTANEAATEVVSDEYIDVALDRSMLDDYSLSVYLSDATAE 137
2 -7.170HGC00593 gi|162858151|dbj|BABB01011554.1|1.0 TMP00709;  ali follow..  19  1MDMTDNNDDVL------VKKFFSENRIDVPDDGF---SRRVMRRLPDRTR----------RISRLWTAVCVVIGLLIFFRN........................................................ 62
3 -6.790PB030138 Q7MX14_PORGI/1-113 PB030138; Pfam-B_30138;  ali follow..  18  8...................KQRKPRSFDHKPIYYDQRRDELEKRIERIRRE...................................................................................... 39
4 -4.190PB032818 Q5LA03_BACFN/1-211 PB032818; Pfam-B_32818;  ali follow..  64QGGKLGLAEKSASRKMLMQD------YGISESFFKEIDTSIKKNCRTQN........................................................................................ 106
5 -4.000PB006154 _JGI.0331794_ 2004021056 [Human Gut Community Subject 7]  ali follow..  17  4..........................ISVPRD-LTKVKSKVMFNLTKRQ------------------LICFGMAVLIGVPSFFLM.................................................... 43
6 -3.550PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali follow..  13  19..........................FACPIIFASIMKKEFIGRTAKS---------------LSLALAIFSGCIFGSVLPAWSQEIVAGELERCFLAMPESVLPIVTMEERNDLCRRAGHLSGFTHTASLES.... 110
7 -3.500HGC00374 gi|162831834|dbj|BABA01012875.1|1.0 TMP00304;  ali follow..  21  5..............................VHYFDELLERI-RDIRASEK....................................................................................... 23
8 -3.360HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  21.DHNETYADQRDRELDSINAFLRNENIKVNNEYVLFESNGIYMQVIND......................................................................................... 95
9 -3.060PB002794 gi|86143885|ref|ZP_01062253.1| hypothetical protein MED217_03525 [Flavobacterium sp. MED217]gi|85829592|gb|EAQ48055.1| hypothetical protein MED217_03525 [Leeuwenhoekiella blandensis MED217]  ali follow..  17  260.PSDSLMTETLARVYVEQKNFSKA--LKYPEGFFADQIRAIEKLQEN.......................................................................................... 313
10 -3.010HGC00248 gi|162576253|dbj|BAAV01029229.1|2.0 TMP00024;  ali follow..  23  96...........KKIESAIRIVGNENPYHPIRDYLNGL.................................................................................................... 121

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.