current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB003142 Q8DVS6_STRMU/1-162 PB003142; Pfam-B_3142;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MMMSVTFPPGRPLSNFLLEGTIMKLTVYFDGTFWFALVEHVNRKGQYKVFRYPFGKEPKDSDIWNFIAKKLPSLIKKYDHIKTSSHADSIPQPKKMNPKRMQRVLNKSKKQSAVSTKAQAEMQKLHEALKKEKKSQSKEKRQALKQYKYQLKQEKRHQKRQGLast
1 -99.400PB003142 Q8DVS6_STRMU/1-162 PB003142; Pfam-B_3142;  ali  100  1MMMSVTFPPGRPLSNFLLEGTIMKLTVYFDGTFWFALVEHVNRKGQYKVFRYPFGKEPKDSDIWNFIAKKLPSLIKKYDHIKTSSHADSIPQPKKMNPKRMQRVLNKSKKQSAVSTKAQAEMQKLHEALKKEKKSQSKEKRQALKQYKYQLKQEKRHQKRQG 162
2 -5.590HGC00311 gi|163635536|dbj|BABG01000737.1|2.0 TMP00178;  ali follow..  13  4...................................................................................................................PKNLEQLRAEKEQVETQLAQEQHKLKRLENRKKYLEKGERQKRTHR. 49
3 -5.260PB006154 _JGI.0331794_ 2004021056 [Human Gut Community Subject 7]  ali follow..  16  89...............................................................................................QRPKIRPYVTDNYYAALLRQAKAEKEVEEIVRLSQKEKSGEKNIHNAGGVKQSRPDGSKGNRKKR.. 153
4 -4.190PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  23..................................................................................................................AQTSKAAXXXXXXXXXXXXXXXRLAKDAVMGEEAFNNAMQAITNRS.. 68
5 -3.830HGC00429 gi|162734516|dbj|BAAZ01029480.1|1.0 TMP00411;  ali follow..  121......................................QQVTGEIFQAWGAITYAHPLTEREMYELRPSRNNLDIRRQMDAQAQVVGKWEDAHHVPDQKRLTWFYPDFGSYVVKEYVTPDQLAVRVRSIERQEAARAHKEAKRQPPIAEQLKAAQREAQGH. 245
6 -3.810PB030138 Q7MX14_PORGI/1-113 PB030138; Pfam-B_30138;  ali follow..  10  24............................................................................................QRRDELEKRIERIRREVEQEEQAELDGQSSSHDYSGYRPRIRGTFVEGTQHLKERQLQGETQSTRSGR.. 91
7 -3.520PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  33..................................................................................................WDGTINKAKLTKYLQLSSQQNEQVASICDYFQEQMKVANSSKKNSDQKVRNAVYGNLKLMK... 93
8 -3.330PB006205 Q3F123_BACTI/1-181 PB006205; Pfam-B_6205;  ali follow..  118..................................................................................................VNVPKLKKHVFYGHVCVQHDVKDLPIVHSFSEEENDIHAYDVTFLPQKEEVEYVEKDEQTTIKA 181
9 -3.290HGC00509 gi|162658693|dbj|BAAX01000912.1|3.0 TMP00561;  ali follow..  22  27.........................................................................................................RKDEDDMAKSTKTYEERIRALEKKEQESIEATKKLIAQRKELEKRKKAEESKKR... 80
10 -3.190PB036876 Q56VH6_BACFR/1-141 PB036876; Pfam-B_36876;  ali follow..  56..........................................................TDGEIYGQAVHYYDE----------NEIEVGKPIQCQVAVNHVVELTAEEKAEARQNAIRQYQDEEVRRLQNRNKPRTATKATVQEVQQ............... 134

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;