current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst MCTTNAVNEKISYTINMDTQKKHNLSGTIILVSCFLLLAGACDNSDRIETETQANGVLLNFNASTIDATTTETRSFVPIEGFAKNEYIFGMSVTKDNASRGEIFEGSRNLKATMSRPSGDAPWNWEFSNNASGTVVTPRGPEGKPLRVIAYYPAIAGTENFTDGIPFDFTQTNNPQQKEILYNTNTSYTIPSSGGSDKVTIPLKFQHAYSWISIKVTKSVDKGSHKLSGVSIDNLSGGWIKNKGKINPATGMAMQGAIQGPIGEVRTAEVLDPSGDTATPIIYDFLVPAFMDRNVKDDDLVFTLIIDGKKEIFSLGREHLNNDGDTYGFKQGYANTYNVEFNNSSLNMRLLNWTSTRIDGDFGQNVTNPTNYQEMSFYYAEDNGGWTTALast
1 -122.000PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali  100  1MCTTNAVNEKISYTINMDTQKKHNLSGTIILVSCFLLLAGACDNSDRIETETQANGVLLNFNASTIDATTTETRSFVPIEGFAKNEYIFGMSVTKDNASRGEIFEGSRNLKATMSRPSGDAPWNWEFSNNASGTVVTPRGPEGKPLRVIAYYPAIAGTENFTDGIPFDFTQTNNPQQKEILYNTNTSYTIPSSGGSDKVTIPLKFQHAYSWISIKVTKSVDKGSHKLSGVSIDNLSGGWIKNKGKINPATGMAMQGAIQGPIGEVRTAEVLDPSGDTATPIIYDFLVPAFMDRNVKDDDLVFTLIIDGKKEIFSLGREHLNNDGDTYGFKQGYANTYNVEFNNSSLNMRLLNWTSTRIDGDFGQNVTNPTNYQEMSFYYAEDNGGWTTA 389
2 -34.400PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  13  1...................MKIERL--FIYCLLAGTSLLASCNSEDMTDETLSEGMYPLTFTAMQGEVVATQTRVSDYKSKWDGGEVIGVKIGTDGAVGSYTLDSDG--------------------KPTTSTSNIPAYWQSTASQTVYGWYPNTADISLT------GQDNTGNKFPYVLKGVSSKQ-------YSYKENVQLNLEHQLVKFRVKLNGDVP-------NLSDAKVFFYGY---PTCKNEYGTVIPQGDKTYLAT------------RKVGDYYTAMLAPDTKTSNN----FVKIEVYGLTYYYN----------PDIELVKGTVYTYTVNKVDIPYEIIDN...................................... 272
3 -16.500PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  1......................MKTGIRVTVYALLAMILFSCEHKELCFHHPHMVTLRVDFDWKNAPQADPEGMC---------------VYFYPEEGESPIRFDFAGKDGGSVEIKEGRYRILCYNND----TESLLFRGMEGFDTHEGYTRDGNVFESIYGNPAKGSEDERVVICPDMMWGSCADKDKVEWIESSEHVITLYPAELICTYTYEVRNVKNMEYMTQACGSLSSMA-------PSMLFANEELDRECVTVPFETELHLESSKMTGK................................................................................................................. 252
4 -9.520PB011023 A7V2G7_BACUN/1-167 PB011023; Pfam-B_11023;  ali follow..  13  1M---NILNN-------KNKRTSIFKALALCLFAAVSFTFVSCDDDMDIQQS-------YPFTVETMPVPNKVTKGQTVEIRCELKKT-----------------GDFANTLYTIRYFQFEGEGTLKMDNGITFLPNDRYLLENEKFRL-YYTAQGDEAHNFIVVVE-DNFGNSYELEFDF--NRNVKDDGVITVVPIGNFKPLT......................................................................................................................................................................................... 167
5 -8.880HGC00947 gi|162844524|dbj|BABA01000185.1|4.0 TMP01280;  ali follow..  1..................MRKLVKLILLCLIAYPIISIVSSCSEEED--SMNARPMMQCYLYKIDGETERVVNDTLDSLTITAFGTDSIILNNQKRVHGLS--------------------------------------------------LPLRYTADSTVLVFHYSKDVKIKKDTIVIRQKNTPYFL--------SMDCGYQMKQSITGRSYS---RHLLDSIYIQTAEVSIYGTENLK.................................................................................................................................................... 161
6 -8.870PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  1..................MHKIKQMIKYIATLLL-TVLFVACNNGKGQQPSEENEDPKAK-GIWLDDETETPLMRIIGDTIYYSDAQSAPVYFKILKDTLYTYGKDVTHYQIDKQSEYSFWFHSLADNIIKLHKSEDPNDTLAFSFKSVEIIPTYTEVTKKDSVVMYRAYVYINPSQMKVVKTTYSEDGISMDNIYYDNVMHICYAKDITKQMFDVIPTDFLQQAILSDMNFIGIDRKGYHYQALVCIPESPV........................................................................................................................................ 251
7 -8.840HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  10  1......................MKKLLLAMIAVAALISFAACDHNETYADQRDRELDSIN-ARKAGDKAVKLTDTDPNNNEYVLFESNGIYMQVINDGCGDYIAKGKTQNVLCRFTEYCLANRAKICDDAI---------TLTNDVPAWAAMTDEISVKNTSGTFEGYFVDIK----KSLLANTYNSSYYGTVSATVPSGWLIPFTWIKAHVRLLVPHTYGTTSAS................................................................................................................................................................... 222
8 -8.810HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  1..................MMRRKNI---TWVWLLGAAFMVGCGKQVPENIIQPDRMENILYDYHLSISMGNNLSYSDNYQKEAYKNYVF----------------------------------------EKHHITEAEF---DSSMVWYTRHTLASLYKKLGERFRSEKKHMQELLALRENKPAVSLPGDTVDVWYDRKLYWLTDVPLANKVTFEIPADSNFKAKDAFLWSADYIFLSEGERRATMGFNILFDNDSVVGRVKDITCSGVQTLYIKPDSAFAIKSFIYYMDSDSSTNKPGLIIN...................................................................................... 244
9 -8.360PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;  ali follow..  1..................MKTLTFKYLKLFLLAVAMINLTSCEIEIDDFYDDDN............................................................................................................................................................................................................................................................................................................................................... 36
10 -7.420PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali follow..  10.CSSTLPLTPYTPAMPFLTRSRIARVASLLSAGVLALVLLSCDGVGDFGDTNEDPTTANDPNPDLEFTTLQLGVSGSRFDMWRTNLIYTMPIVQHIANPGFYAGNFNQYVGAWSASFRTVTNAETLISELEGKPRQVNRLAATRIMRVLTFQPYFDAGKGALEGEFTPHYTRQDSIYMDLHDELRAAVDQFDASQPTFGGADLFFNGSIEQ.................................................................................................................................................................................. 248

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 5 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.