current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB008694 Q9F6U1_BACTN/1-190 PB008694; Pfam-B_8694;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MLRRSVPKSIWRTPPRKRRKWRFTVWRRSWAATSKPPSGNLPKSGETRKQPTIKNEFINEKRKMRMNLPKVKMLQVSKCLIGLAVMMLQSCDVADNLRDMLCGNWESVEGKPDVLIYKEGEAYKVTVFRRSGLRRKLKPETYLLQEENGNLFMNTGFRIDVSYNEATDVLTFSPNGDYVRVKPQPENQTELast
1 -103.000PB008694 Q9F6U1_BACTN/1-190 PB008694; Pfam-B_8694;  ali  100  1MLRRSVPKSIWRTPPRKRRKWRFTVWRRSWAATSKPPSGNLPKSGETRKQPTIKNEFINEKRKMRMNLPKVKMLQVSKCLIGLAVMMLQSCDVADNLRDMLCGNWESVEGKPDVLIYKEGEAYKVTVFRRSGLRRKLKPETYLLQEENGNLFMNTGFRIDVSYNEATDVLTFSPNGDYVRVKPQPENQTE 190
2 -8.850PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  11  2.....................................................................KRNYFFTMLAAVLLAVAGANAQESAEFRPAELAGIWQILKPSNTFKVLSDDGRIVNFTMIPGKDAIITGYGTYQQLTDNSYKES-DHKDNILEFEIGDDGVMYLKYFIWKRVGMPAKFPED 160
3 -5.140PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;  ali follow..  12  1...................................................................MKTLTFKYLKLFLLAVAMINLTSCEIEIDDFLDLCSRWADTFYDADLNFYLDRHGEDYIRVEYPNGRYSESVYSFTWNWED-----RSQYSLRMVYGPGDVSYL................... 121
4 -4.760PB009233 Q7MX23_PORGI/1-175 PB009233; Pfam-B_9233;  ali follow..  20  1...............................................................MGAAVRKQVRGAISFFLVALGICLAVSCTYRKDERILYRGRWQKRDVLDEILIPDYTRSYSLEL............................................................... 69
5 -4.530PB011023 A7V2G7_BACUN/1-167 PB011023; Pfam-B_11023;  ali follow..  17  1.........................................................MNILNNKNKRTSIFKALALC--LFAAVSFTFVSCDDDMDIQQSYPFTVETMPVPNKVTKGQTVE-IRCELKKTGDFANTLYTIRYFQFEGEGTLKMDNGITF............................... 99
6 -4.470PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  1.........................................................MHKIKQMIKYI-----------ATLLLTVLFVACNNGKGQ-EILQGIWLDDETETPLMRIIGDTIYYS--------DAQSAPVYFKILKDTLYTYGKDVTHYQIDKQSEYSFWFHSLADNIIKLHKSEDPNDT 125
7 -4.020PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  21  4.........................................................TNAVNEINMDTQKKHNLSGTIILVSCFLLLAGACDNSD............................................................................................... 46
8 -3.950PB028090 gi|167758043|ref|ZP_02430170.1| hypothetical protein CLOSCI_00381 [Clostridium scindens ATCC 35704]gi|167663940|gb|EDS08070.1| hypothetical protein CLOSCI_00381 [Clostridium scindens ATCC 35704]  ali follow..  30LARRTGGIFCFLIVP-------TVYFIAEWALNN-PTYVHMNSWFHYAKAATAGCIGFMMLKYKWKIGKTNWFKVFPFVIVAINIL........................................................................................................ 123
9 -3.920PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali follow..  18  3.............PP---SPWRFGCYLLLFAC---------P---------IMKKEFIGRTAKSLSLALAIFSGCIFGSVLPAWSQEIVA.................................................................................................... 66
10 -3.760HGC00422 gi|163631722|dbj|BABG01004545.1|2.0 TMP00397;  ali follow..  16  177VLSNTVQLQDW----------RYSRRNKEWAKTPNDNPETVRCGYALNSHPAVLDGFIDLVREEQQRSRTQR...................................................................................................................... 241

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.