current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB010473 Q8A4J5_BACTN/121-234 PB010473; Pfam-B_10473;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst PAFLLPLEAMEYEINKGAGNPLEFKGLKSQYLFIFAGGLVAVLLVVVILYIAGVNQWICIPFGLLSGSLLVWLTFRLNARYGEHGLMKLLSGKRHPRYLIHRRRLFRLLTKRRKLast
1 -87.900PB010473 Q8A4J5_BACTN/121-234 PB010473; Pfam-B_10473;  ali  100  1PAFLLPLEAMEYEINKGAGNPLEFKGLKSQYLFIFAGGLVAVLLVVVILYIAGVNQWICIPFGLLSGSLLVWLTFRLNARYGEHGLMKLLSGKRHPRYLIHRRRLFRLLTKRRK 114
2 -6.760PB006154 _JGI.0331794_ 2004021056 [Human Gut Community Subject 7]  ali follow..  1........ASYISVPRDLTK-VKSKNLTKRQLICFGMAVLIGVPSFFLMKTVMKTNTAVMGMMVIMMPFFFLAMYEKNGQPLEVILEHMIQAIQRPKIRPYVTDNYYAALLRQA 109
3 -4.100PB002104 Q72PH8_LEPIC/1-220 PB002104; Pfam-B_2104;  ali follow..  24  52......IVKKVYEVNDGFNIG---SGLLAKFILYFVGFFFDLILFNLIEFWSGNN........................................................... 108
4 -3.550PB001708 Q3IRP6_NATPD/1-505 PB001708; Pfam-B_1708;  ali follow..  14  1.............MNEGIPEQLIRR---SDASRLVPLALLAVVAAVIYVWRPLFHGLIYRVAYSPSLLILVGTTVVAGIALVFWPRMGEDPLESAVTKWSILGTIVVAAL.... 95
5 -3.500PB006205 Q3F123_BACTI/1-181 PB006205; Pfam-B_6205;  ali follow..  11  17...YMNYMRRQYEIMGRLPRAVTWRA-----LGYFAAVEAGLVAFRFLPPFKWIFGDMIDQVWLMYYGVIPLFLVWGADKYKTDG............................. 94
6 -3.470PB038151 Q8A4A5_BACTN/1-178 PB038151; Pfam-B_38151;  ali follow..  13  15..............HPDIAKRTSISGLLISCVML----LIGILSFASTFELEDKSSTVSMALMVFGTGLFLLGIFRL..................................... 73
7 -3.280PB060121 Q64SA7_BACFR/1-251 PB060121; Pfam-B_60121;  ali follow..  10  1......MKKEQFEFNELPYPTLARFGLTQEMIEDLPLCILKEIG-------KGGYSPVLPMRVTNENGEVIESRSRFAFIRMDSGEVDVVFY...................... 79
8 -3.220PB062605 Q9F6T7_BACTN/1-105 PB062605; Pfam-B_62605;  ali follow..  20  58...LYTFGRAAYDIGRNDGSRMETGHAGRVEL.................................................................................. 86
9 -2.720HGC01179 gi|162738527|dbj|BAAZ01025469.1|2.0 TMP01658;  ali follow..  18  3..........VSILFQKARKVLNNERGEANYFSTVVFIFIAVLLLAFIIDLFSI............................................................ 46
10 -2.710PB011051 Q8A0P0_BACTN/1-227 PB011051; Pfam-B_11051;  ali follow..  20  8.VLVLCAAALIYICYSSIMGPINFEKAKKE.................................................................................... 36

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.