current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB011023 A7V2G7_BACUN/1-167 PB011023; Pfam-B_11023;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MNILNNKNKRTSIFKALALCLFAAVSFTFVSCDDDMDIQQSYPFTVETMPVPNKVTKGQTVEIRCELKKTGDFANTLYTIRYFQFEGEGTLKMDNGITFLPNDRYLLENEKFRLYYTAQGDEAHNFIVVVEDNFGNSYELEFDFNNRNVKDDGVITVVPIGNFKPLTLast
1 -91.700PB011023 A7V2G7_BACUN/1-167 PB011023; Pfam-B_11023;  ali  100  1MNILNNKNKRTSIFKALALCLFAAVSFTFVSCDDDMDIQQSYPFTVETMPVPNKVTKGQTVEIRCELKKTGDFANTLYTIRYFQFEGEGTLKMDNGITFLPNDRYLLENEKFRLYYTAQGDEAHNFIVVVEDNFGNSYELEFDFNNRNVKDDGVITVVPIGNFKPLT 167
2 -12.300PB009233 Q7MX23_PORGI/1-175 PB009233; Pfam-B_9233;  ali follow..  12  1MGAAVRKQVRGAIS----FFLVALGICLAVSCTYRKDERILYDYEILIPDY------TRSYSLELLIRHDNRYEYRDLALAYEVSVGERLIF---------ADSVDLTLADKPQQWNGKGVAKQQNRFRLPISARFPYSGLYKIELKH................... 143
3 -12.200PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  11  1............MKTGIRVTVYALLAMILFSCEHK-ELCFHHP---------------HMVTLRVDFDWKNAPQADPEGMCVYFYPEEGESPIRFDFAGKDGGSVEIKEGRYRILCYNNDTESLLFR........................................ 99
4 -11.900PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;  ali follow..  14  1........MKTLTFKYLKLFLLAVAMINLTSCEIEIDDFYDDDNIGGSYYNKSLDLCSRP-----------------WADTFYDADGN----------------------YQELNFYLDRHGEDYIRVEYPNGRYSESVYSFTWNWEDRSQY............... 107
5 -11.400HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  13  1............MKKLLLAMIAVAALISFAACDHN--------------ETYADQRDRELDSINAFLRNEN-INEAEFEKRFEARKAGDKAVKLTDTDPNNNEYVLFESNGIYMQVINDGCGDYI-------AKGKTQNVLCRFT...................... 114
6 -11.200PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  13  1MKIER-----------LFIYCLLAGTSLLASCNSEDMTDNPYPLTFTAMQGEVVATPQTRVS-VIGVKIGTDGAVGSYTLKPTTSTSNIPAYWQSTASQTVYGWYPNTA-DISLTGQDNTGNKFPYVLKGVSSKQYSYKENVQLNLEHQLVKFRVKLNGDVPNLS.. 181
7 -9.520PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  13  1MNAVNEMDTQKKHNLSGTIILVSCFLLLAGACDNSDRIETELNFNASTIDATTTETRSFVPIEGFAKNEYEGSRNLKATMSRPSGDAPWNWEFSNNASGTVVTPRGPEGKPLRVAYYPAIAGTENFTDGIPDFTQTNNPQQKEI-NTNTSYTIPSSGGSDKVTIPLK 204
8 -8.460HGC00947 gi|162844524|dbj|BABA01000185.1|4.0 TMP01280;  ali follow..  1........MRKLVKLILLCLIAYPIISIVSSCSEEMNARPMMQCYLYKIDGETERVVNDTLDS--SIILNNQKRVHGLSLPLRYTADSTVLVFHYSKDVKIKKDTIVIRQKNTPYFLSMDCGRHLLDSIYIQTAEVSIYGTENLKL..................... 162
9 -8.200PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  12  1MK----------IKFLSFIASFFMVSFVITSCLDD---------------DNNIEYSPDATIHAFALDTAGLGS-----YKFTIDQLSREIYNEDSLPVHADTI------IDKILIKTLTTASGVVTMKDKSGNDSVININDSIDLRE................... 112
10 -7.860HGC01213 gi|163579070|dbj|BABE01006032.1|2.0 TMP01709;  ali follow..  109..............................DCSAS-------DVTLQLSAASQSVPVGGSLDFTATIVHEGSVDGSDSGRVLTITSGQETI--KSDVCPADSRLLLMAKGVQKVTWNTNANGTYVAQLSLKDHPKVKSD-PVTFTVQ.................... 240

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.