current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB014998 gi|86133284|ref|ZP_01051866.1| hypothetical protein MED152_01230 [Tenacibaculum sp. MED152]gi|85820147|gb|EAQ41294.1| hypothetical protein MED152_01230 [Polaribacter dokdonensis MED152], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MSILKITEELQNLGNAGKDNRQRVANIVLENKELFEPLLEVTFQVDEPISVKAAWVLEWICTHHQLSWMIPHLTFFTENLKNLTFDSAIRPCAKICEHLANAYYSKRDNEFKSKLKNEHIQEIIETGFDWLITPQKIAVRAYTMNTLYLFGLENDWVHPELKHLIETKIIHESKGTKARGKHILNLIEKHQKSLast
1 -71.000PB014998 gi|86133284|ref|ZP_01051866.1| hypothetical protein MED152_01230 [Tenacibaculum sp. MED152]gi|85820147|gb|EAQ41294.1| hypothetical protein MED152_01230 [Polaribacter dokdonensis MED152]  ali  100  1MSILKITEELQNLGNAGKDNRQRVANIVLENKELFEPLLEVTFQVDEPISVKAAWVLEWICTHHQLSWMIPHLTFFTENLKNLTFDSAIRPCAKICEHLANAYYSKRDNEFKSKLKNEHIQEIIETGFDWLITPQKIAVRAYTMNTLYLFGLENDWVHPELKHLIETKIIHESKGTKARGKHILNLIEKHQKS 193
2 -3.390PB000795 Q74Z21_ASHGO/1-280 PB000795; Pfam-B_795;  ali follow..  204...............................................................................................................................ADLVWPNWQARALYIDFWMLGDAARELPDARELGNLVMNMFDPEDVSTVDKCRKFLQKEFFDKYTD 276
3 -3.160PB047024 _Gut.Meta.Jp.0098985_ gi|162869273|dbj|BABB01000734.1||6 (+ 5047:5650~0 complete)  ali follow..  12  111..........................................................................................................................VCEMFIDRVSASKNYQKEKYTDKSALEYYEKSVDIHPDTKAMLEYLLVMLSVKGEEYTYSYIKKEVLKGHI 184
4 -2.960PB002794 gi|86143885|ref|ZP_01062253.1| hypothetical protein MED217_03525 [Flavobacterium sp. MED217]gi|85829592|gb|EAQ48055.1| hypothetical protein MED217_03525 [Leeuwenhoekiella blandensis MED217]  ali follow..  238.......PKIKVSTPDSNFKKPNLEDRFQPSDSLMTETLARVYVEQKNFS-KAKQAYRILSLKYPEK--SGFFADQIRAIEKLQEN........................................................................................................... 313
5 -2.500PB009510 _JGI.0345302_ 2004041369 [Human Gut Community Subject 8]  ali follow..  3....................LSYVTPGFYDKSYVGKWMFQVMGLEYDKALKLAEELPEQFFPETATWGLCWHEIKW---LPVQENLSYQERRQAIYEKR----------DYHSPMTPYIMERYLENATGFIADCHDAGPLKYKPPHPNVFKAFFNGDGTLDSKKVRKLIDKLKES.................. 148
6 -2.400PB006101 JCVI_PEP_1096697844517 /source_dna_id=JCVI_ORF_1096697844516 /offset=0 /translation_table=11 /length=371 /full_length=371  ali follow..  11  37........................................LIVMDSTKFKGKIGRELVDIYSSYISGLPQPEPRYDLRYIKPRKFNSILKHAKNIVVAFSLEGNSLDSEILRRNFNSESLDKIQSDSSLFYFVRRNQYARGQVVLYLF--SENDDDLYSKIKRNRNSILKFFDDELKKRVDTEIFRKVENN.. 185
7 -2.380PB005684 gi|160884252|ref|ZP_02065255.1| hypothetical protein BACOVA_02230 [Bacteroides ovatus ATCC 8483]gi|156109991|gb|EDO11736.1| hypothetical protein BACOVA_02230 [Bacteroides ovatus ATCC 8483]  ali follow..  10  184NTGTGILQNIMDSDGTGEAEADTLSTAIGSDHGHWSDTLRKAFDHDRLSYNRRTDQEYREVKKSYLSVLISGTPSQVQTFIPTAEDGSYSRQ--LYYYMCGISKWISQFMDNEIDWEEIFTAMGLEWKEKLSVIKTHGIHTLQLT---EQKEEIDTVFSDLFERSSVANGREMYSFVARLAVNLCRI...... 369
8 -2.070HGC00150 gi|162733542|dbj|BAAZ01030454.1|1.0 TMP01074;  ali follow..  15IDELGLSAQAARNLYAGKAN-AQVVNYLLESPRFFNDTVAAGYAAQNQLYTTISSLTRKTVKTEAGEQAARDIAHLRTSVYQADLVTIENQFMLAVKEV------KKEIGNDFAAMQSMTAEAAKRMFTEVAKGQDMTNPTITPEQVSDL-DALNTLGQALTGFFQNHLRAAQYR-RQDNEQLCALAQKGTQS 226
9 -1.790HGC00878 gi|162869432|dbj|BABB01000575.1|7.0 TMP01167;  ali follow..  40....SVDAEFSSRWVYPEEEIKKLVESLEDKDKVYIKILTYEFEDEYRIFSQGEWKVKLVTE................................................................................................................................... 100
10 -1.770PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF  ali follow..  129...........................................................................................................................................................NFIGYFREAMYKRHKNSSTSILVNWKRAMDFLKMYAGE 166

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.