current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MSNILILIIGVLVLGLVAALTEIRHSHKRRAAEAKGESLPEEPVRVVPPGCCGMHITCEKDSLLTAVSKSIVYYDDEELDRYAGVLPEEYNTEAVEEFEEILSTLQEEEVPSWIRSLQMRQIQMPISIKEQALFIVSEHRIQHRHDLast
1 -96.600PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali  100  1MSNILILIIGVLVLGLVAALTEIRHSHKRRAAEAKGESLPEEPVRVVPPGCCGMHITCEKDSLLTAVSKSIVYYDDEELDRYAGVLPEEYNTEAVEEFEEILSTLQEEEVPSWIRSLQMRQIQMPISIKEQALFIVSEHRIQHRHD 146
2 -5.520PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  18  1MHKIKQMIKYIATLLLTVLFVACNNGKGQQPSEENEDPKAKEILQ-------GIWLDDETETPLMRIIGDTIYYSDAQ.................................................................... 71
3 -5.410HGC00947 gi|162844524|dbj|BABA01000185.1|4.0 TMP01280;  ali follow..  11  1MRKLVKLILLCLIAYPIISIV----------------------------SSCSEEEDCSMN---ARPMMQCYLYKIDGETERVVNDTLDSLTITAFGTDSIILN----------NQKRVHGLSLPLRYTADVLVFHYSKDVKIKKD 107
4 -5.260PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;  ali follow..  10  1MKTLTFKYLKLFLLAVAMINL---TSCEIEIDDFYDDDNIGGSYYNKSLDLCSRPWADTFYD--NYCYQELNFYLDRHEDYIRVEYPNGRYSESVYSFTYSLRMVYGPGDVSYLDDVWIRGNVLSGYLDGHDNYVDFT........ 145
5 -4.580PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  12  1MKIKFLSFIASFFMVSFVI------------------------------------TSCLDD------DNNIEYSPDATIHAFADTAGLGSYKFTIDQLSREIYNEDS----------------LPVHADTIIDKIL.......... 79
6 -4.560PB044380 A7LRP7_BACOV/1-223 PB044380; Pfam-B_44380;  ali follow..  11  1MGTIVYLSIRLACACYILYKVCGQKK-TKLPPVKEKELENVLSEPGGESGIMGSTCFVYLDEDAGKSVAEEEDVAEEEVECKLPLEEMRMLKEEPDDLDNAGNVLFKLNDADKDEEKSLRAALTLHTIRETDLIFSSQVENKNV.. 189
7 -4.010PB044572 Q8A533_BACTN/1-343 PB044572; Pfam-B_44572;  ali follow..  10  23RTALCCSVVGMLLTLLFLSSCHYTRPDLTSEELSEKTKDSLNYLYDRHYTWNTNLEVTTDSVTMECLPIKDTYIALYKGDRVVVAEFAIHPADSVDSV---VKLAHTQEEQGWIRETELKESFVPTDSISQAIHFFSDTH...... 160
8 -3.970PB044822 Q89ZL7_BACTN/1-147 PB044822; Pfam-B_44822;  ali follow..  10  38...............................................................PDQTSGQLTIYNDDDIEEWATYDGDDFMENVKPNLKSTLCRMKDAGDFDKVTILKPYSFVLVDEDKETVAELL.......... 117
9 -3.870PB011051 Q8A0P0_BACTN/1-227 PB011051; Pfam-B_11051;  ali follow..  12  1MKTVFNIVLVLCAAALIYICYSIMGPINFEK---------------------------AKKEREQAVIARLIDIRKAQQ-EYRSLHHGMYTEH----FDTLIDFVKNQKLP................................... 80
10 -3.520HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  2MRRKNITWVWLLGAAFMVG-----------GKQVPENIIQPDRMENILYDYHLSISMGNNLSYSDNYQKEAYKFEKHHITEAEFDSSMVWYTRHTEELASLYKKLGE--------RFRSEKKHMQELLALR............... 117

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.