current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB040621 Q8A865_BACTN/1-132 PB040621; Pfam-B_40621;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MKYVKILFAMALVLTMCSAFSLKKGHSKTVYAFGIAASFTDTVVYFTDIQILDSAKVSKEGFLTHRDLYSYQLKNYVEDNGLQQNSTCMIYFSENRKKLEKEATKILSKYKRNRNTTVTRIDTDKFHFIKPELast
1 -81.200PB040621 Q8A865_BACTN/1-132 PB040621; Pfam-B_40621;  ali  100  1MKYVKILFAMALVLTMCSAFSLKKGHSKTVYAFGIAASFTDTVVYFTDIQILDSAKVSKEGFLTHRDLYSYQLKNYVEDNGLQQNSTCMIYFSENRKKLEKEATKILSKYKRNRNTTVTRIDTDKFHFIKPE 132
2 -6.650HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  2MRRKNITWVWLLGAAFMVGCGKQVPEN---------IQPDRMENILYDYHLSISMGNNLSYSDNYQKEKNYVFEKH--HITEAEFDSSMVWYTRHTEELASLYKKLGERFRSEKK................. 108
3 -5.960PB004718 Q5LIA4_BACFN/1-189 PB004718; Pfam-B_4718;  ali follow..  18  1MKVKTSILLLLMIATALPSFGGNGNGNGTATMYGVGTNVFDT--YLSPQE.................................................................................. 60
4 -5.790PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  15  1MKIKFLSFIASFFMVSFVITSCLDDDNNTIHAFALDTAGLGSYKF--TIDQLSREIYNEDSLPVHADTIIDKI........................................................... 78
5 -5.620PB053359 gi|153891307|ref|ZP_02012332.1| conserved hypothetical protein [Opitutaceae bacterium TAV2]gi|151582630|gb|EDN46158.1| conserved hypothetical protein [Opitutaceae bacterium TAV2]  ali follow..  10  16.............................AYRCGAFQLLAQMALRRELPEGVAPAQV-RGALTAVIRRTLGAPGTFDNDTGNDGAGWLRIGLAGHQPGLGEVYISTGSLYLCTTAFLPLGLPASDDFWSQPD 117
6 -5.380PB009671 Q5LCM2_BACFN/1-111 PB009671; Pfam-B_9671;  ali follow..  12  1MKKVLVALTMVMGMGSAVAFAQEPVKLPAMEQNQQTSQDKFTKITVKELPQVVKSTLSKD----NGKVYKIIVTAIKEDQSTEEIT---VLLNEKGEPVNEK.............................. 110
7 -4.840PB012954 Q5LF97_BACFN/1-383 PB012954; Pfam-B_12954;  ali follow..  12  1MNY-KPIYITTLLLLFFLSGRAQKIEELTAVPLQIGYEKTLHLIFPTEVKYYS---IGGDYVIGEKVVNCPGIIRLKAAEENFPGETTLSVVTADTK................................... 93
8 -4.750HGC00044 gi|162658718|dbj|BAAX01000887.1|1.0 TMP00920;  ali follow..  13  32.......................NYDNEVAYGFGYGLSYTTFTQEIQGQPEISNVKVTNTGKVPGKT-YAIQLLNFEKSSELAPGASEIVSVKVDLQYIASYDMEHDNGDGTTGTYVLD---PGTYYFA... 166
9 -4.310PB007740 Q89YT2_BACTN/1-193 PB007740; Pfam-B_7740;  ali follow..  11  1MKTKFIYVVLMALFLGSQMTLSAQNEENK----------QMQTNQMVRALMLDDA--TAAKFTPIYEKYLKELRECRMMNFKPRARK-IAKMLKDQFAQSRKMLDIREKYYNEFSKIL.............. 140
10 -4.310PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  17  1MKRNYFFTMLAAVLLAVAGANAQESAEFR--LAG.................................................................................................. 35

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.