current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MKRNYFFTMLAAVLLAVAGANAQESAEFRPAELAGIWQLCHYVSEIPDVPGILKPSNTFKVLSDDGRIVNFTMIPGKDAIITGYGTYQQLTDNSYKESIEKNIHLPMLDHKDNILEFEIGDDGVMYLKYFIAKDLNGNELNTWFHETWKRVGMPAKFPEDLVLast
1 -77.700PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali  100  1MKRNYFFTMLAAVLLAVAGANAQESAEFRPAELAGIWQLCHYVSEIPDVPGILKPSNTFKVLSDDGRIVNFTMIPGKDAIITGYGTYQQLTDNSYKESIEKNIHLPMLDHKDNILEFEIGDDGVMYLKYFIAKDLNGNELNTWFHETWKRVGMPAKFPEDLV 162
2 -14.300PB047496 gi|150008556|ref|YP_001303299.1| hypothetical protein BDI_1942 [Parabacteroides distasonis ATCC 8503]gi|149936980|gb|ABR43677.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  13  1MKKLLCMWMVVCGLLLIPGNMKGQSKAVTFENLQGTWMYVNPALQLEGDNALKNVAGSLAVFNSDSTFTSALKRGS-------KGTYSVSPEDKTV-TLRYTVGNKKLTVSTLTAHVVLSGNELTLL................................... 164
3 -13.700PB083081 gi|160890648|ref|ZP_02071651.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]gi|156859647|gb|EDO53078.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]  ali follow..  13  1MKKTIFYSLFSALFMLTSCSMFEDNYEEPSETIWG--EVVDEATGKRVLTDQGSEGIRVRLTMMDGTFQNTKIFK---------GEYNVRIDGPFIPLVRENTDGT--LLHDGSVNTEISGTT....................................... 127
4 -12.600PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  20  7MIKYIATLLLTVLFVACNNGKGQQPSEENKEILQGIWLDDE----------------------------------------TETPLMRIIGDTIY-------------DAQSAPVYFKILKDTLYT.................................... 86
5 -12.600PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  16  1MKTGIRVTVYALLAMILFSCEHKELCFHHPHMVT-----LRVDFDWKNAPQADPEGMCVYFYPEEGESPIRFDFAGKDGGSVEEGRYRILCYNNDTESLLFRGME......................................................... 102
6 -11.200HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  1MKKLLLAMIAVAALISFAACDHNETYADQRDR----------------------ELDSINAFLRNENIKVINEAEFEKRFEARKAGVLFESNGIYMQVINDGCGDYIAKGKTQNVLCRFTEYCL...................................... 118
7 -11.200PB023339 Q8A4U7_BACTN/1-171 PB023339; Pfam-B_23339;  ali follow..  12  1MKTTVLFRMMVLVAMVVAGIANTELKAQDNNNEEKVDDLVVSKVIYRLDGSLYRHMKYDFTYDDQKRVTAKEASSTEKWIPYFKIDYAYSSNEITLVYARWNNSHRAYDDSVEKSVYELNDANMPIAYMNYKWNDYKWIEESAGNWAM.............. 155
8 -10.200HGC00683 gi|163310582|dbj|BABD01000118.1|4.0 TMP00861;  ali follow..  11  1MKTLKITFVMLMTALFLVLPSCSKDDVNVTLTP--KWEILVGAYEAEGQHIVLDKVEAQAYITQGGKWVRSEFDVTKDYQDSSSLVVAVRETIAAKGKKVDDVKLFDWSDRNDYFYVEFDEPDSELL................................... 155
9 -8.830PB008694 Q9F6U1_BACTN/1-190 PB008694; Pfam-B_8694;  ali follow..  11  70.KVKMLQVSKCLIGLAVMMLQSCDVADNLRDMLCGNWE-------------SVEGKPDVLIYKEGEAYKVTVFRRSGLRRKLKPETYLLQEENGNLFM----------TGFRIDVSYNEATDVLTFSPNGD----------------YVRVKPQPENQTE.. 190
10 -8.770HGC00552 gi|162599220|dbj|BAAV01006262.1|2.0 TMP00636;  ali follow..  1MRKIVMLVVVLAITCLMATTAFAAGTGDVAGAVESTWSTASTQIKSVVDNVVFPAIDLILAVFFFAKLGTAYFEYRK------SGQFEWAAPAILFACLVFTLTAPMYL..................................................... 109

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 8 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.