current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB044822 Q89ZL7_BACTN/1-147 PB044822; Pfam-B_44822;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MKLSQQSLSTIESAIQKAAGKYVCGCDQTAVTDIHLQPDQTSGQLTIYNDDDEELANVMIEEWATYDGDDFMENVKPNLKSTLCRMKDAGDFDKVTILKPYSFVLVDEDKETVAELLLIDDDTLLVDDELLKGLDKELDEFLKNLLELast
1 -71.900PB044822 Q89ZL7_BACTN/1-147 PB044822; Pfam-B_44822;  ali  100  1MKLSQQSLSTIESAIQKAAGKYVCGCDQTAVTDIHLQPDQTSGQLTIYNDDDEELANVMIEEWATYDGDDFMENVKPNLKSTLCRMKDAGDFDKVTILKPYSFVLVDEDKETVAELLLIDDDTLLVDDELLKGLDKELDEFLKNLLE 147
2 -3.970PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali follow..  10  64.....................................LTAVSKSIVYYDDEE-------LDRYAGVLPEEYNTEAVEEFEEILSTLQEEEVPSWIRSLQMRQIQMPISIKEQALFIV.............................. 136
3 -3.630PB008806 Q5L9W8_BACFN/1-127 PB008806; Pfam-B_8806;  ali follow..  13  44....................................ILQQTMSITQIRIKPTDNINHINVSDWFKEQLNKLNQSVRMKQRQKIVRVQSSNDSILLDFSKKVKF............................................ 116
4 -3.270PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  11  4..................IKQMIKYIATLLLTVLFVACNNGKGQQPSEENEDPKAKEILQGIWLDDETET-----------PLMRIIGDTIYYSDAQSAPVYFKILKDT...................................... 83
5 -2.550HGC00485 gi|163636056|dbj|BABG01000217.1|3.0 TMP00523;  ali follow..  13  83....................KILSDVVAQFYAYLSGCMFNDPVGMAIYAELHYMMSSLMLGEWFE.................................................................................. 127
6 -2.530PB162020 _JGI.0344610_ 2004040329 [Human Gut Community Subject 8]  ali follow..  8VQAEQQRLEAVTAQVADVEQSLEKEKQKKKLEALQKETKAARATALTVQDIEAMGKKATFGNNITLTPDECRTLKDYAVSSFAEKAEKLKYKQKYEQAEKSASVWKRRFEALNEKYLELKKKA-----DALEIASEKVRAFLDAVLA 158
7 -2.260PB007740 Q89YT2_BACTN/1-193 PB007740; Pfam-B_7740;  ali follow..  10  19MTLSAQNEENKERKQRPTPEQMMQMQTNQMVRALMLDDATAAKFTPIYEK-------------YLKELRECRMMNFKPRARKDAAQGTEANTAKETPKPVMT----AEIAKMLKDQFAQSRKMLDIREKYYNEFSKILKSNMNKFRK 161
8 -2.250PB001030 Q6D4H5_ERWCT/1-146 PB001030; Pfam-B_1030;  ali follow..  14.................................................QREIRTVGLMIALYEKRHETDASTQYNDLFSYAIKRLERCHFGEDKPACKHCPICYQPARREAIKAIMRWSGPRMLLRHPIL................ 97
9 -2.180HGC00965 gi|163282470|dbj|BABD01028218.1|2.0 TMP01310;  ali follow..  10  57......................................................................................KEEAILTVDLWPEPWTLDKTDPALRRREIFPMTEEGRTAVAQYLNDAYNAEPERW...... 111
10 -2.040PB047024 _Gut.Meta.Jp.0098985_ gi|162869273|dbj|BABB01000734.1||6 (+ 5047:5650~0 complete)  ali follow..  13  106..............................MPIRYVCEMFIDRVSASKNYQKEKYTDKSALEYYEKSVDHIHPDTKAMLEYLLVMLSVKGEEYTYSYIK................................................ 176

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.