current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB044863 Q5LB69_BACFN/1-105 PB044863; Pfam-B_44863;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MYTIQANPSGTRSMEISEENLVTIEKYSLFQHLIDSNGIVDEAVLEKLKLNIRSLIASQEEDSKDLLDLCIDVIYHNNMKAFGLQQLIKLYLTWLSKQEAEEEEELast
1 -87.800PB044863 Q5LB69_BACFN/1-105 PB044863; Pfam-B_44863;  ali  100  1MYTIQANPSGTRSMEISEENLVTIEKYSLFQHLIDSNGIVDEAVLEKLKLNIRSLIASQEEDSKDLLDLCIDVIYHNNMKAFGLQQLIKLYLTWLSKQEAEEEEE 105
2 -2.880PB046158 _JGI.0336690_ 2004028347 [Human Gut Community Subject 8]  ali follow..  12  77IKQLNAQGVQLSNIKITDENIKSFDRYSLKKEVGADPPFFKAKDVDVMTAAFREYAGVELKKKQV........................................ 153
3 -2.800HGC01179 gi|162738527|dbj|BAAZ01025469.1|2.0 TMP01658;  ali follow..  10  2...........................................VVSILFQKARKVLNNERGEA-NYFSTVVFIFIAVLLLAFIIDLFSIISTKQELDHAADQ... 59
4 -2.660HGC00787 gi|162657578|dbj|BAAX01002027.1|2.0 TMP01033;  ali follow..  11  120.........DGDRMVITVPDSAPLLELQQADVPVGVQLSFDETSYKMMFDALDRTMKAKNNRLAYLRDLFYS................................. 182
5 -2.370HGC00106 gi|162841414|dbj|BABA01003295.1|1.0 TMP01000;  ali follow..  25  31.............VYVSGNNLFCITGYSGLDPELDISNVQAPGV............................................................. 61
6 -2.350PB011130 gi|88806557|ref|ZP_01122074.1| hypothetical protein RB2501_00756 [Robiginitalea biformata HTCC2501]gi|88783389|gb|EAR14561.1| hypothetical protein RB2501_00756 [Robiginitalea biformata HTCC2501]  ali follow..  10  1MNKTVNINLANMLFHIDENAYQKLLRYLEAVKRSFAGTAGSDEIIADIEARIAELFYEKMENERQVITQ.................................... 69
7 -2.240PB001823 Q5L7Q9_BACFN/1-326 PB001823; Pfam-B_1823;  ali follow..  19  261.......SNGNGTFSYPQEKNSLFETYPGFSDWINGKV--GSFQKELVYKYCSGGIIGEDGK--DYLDL.................................... 326
8 -1.990PB202086 Q8G498_BIFLO/2-200 PB202086; Pfam-B_202086;  ali follow..  15  152..............................KSLSKAVRAVVESKAAKRLDDAKTNLTAKLDEASKLLA..................................... 189
9 -1.850HGC00803 gi|163280588|dbj|BABD01030100.1|2.0 TMP01051;  ali follow..  12  2.........NEKGAIPMK---AFDPNYKLLDEMYQDD-YYPAFLVDKVKDELQKVIDLLESGETDTEVI.................................... 57
10 -1.850HGC00374 gi|162831834|dbj|BABA01012875.1|1.0 TMP00304;  ali follow..  17  4........................................EVHYFDELLERIRDIRASEKRVYRKVKEI.................................... 32

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.