current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB050904 Q64SA2_BACFR/1-230 PB050904; Pfam-B_50904;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MKSRIISLGLVASLVCLLPQVAEAQIAASNPLEWTALAEGNELINGQIEKQIKGQTQTALLQNSIATEFNQIHKWEKQYNSYLKTASGYASSLKACTHLYNDGVRIFLTLGKLGKAIQNNPQGIVASMNMNNLYIETATELVSVFTLLNDAVAKGSNENMLTGAERSKTLWALNDQLSDFSRKLHLLYLSIRYYTFNDVWNNVTAGMLDRDNGEAARMALSHWHRAAALVLast
1 -82.400PB050904 Q64SA2_BACFR/1-230 PB050904; Pfam-B_50904;  ali  100  1MKSRIISLGLVASLVCLLPQVAEAQIAASNPLEWTALAEGNELINGQIEKQIKGQTQTALLQNSIATEFNQIHKWEKQYNSYLKTASGYASSLKACTHLYNDGVRIFLTLGKLGKAIQNNPQGIVASMNMNNLYIETATELVSVFTLLNDAVAKGSNENMLTGAERSKTLWALNDQLSDFSRKLHLLYLSIRYYTFNDVWNNVTAGMLDRDNGEAARMALSHWHRAAALV 230
2 -6.770PB007740 Q89YT2_BACTN/1-193 PB007740; Pfam-B_7740;  ali follow..  1MK-TKFIYVVLMALFLGSQMTLSAQ-------------KERKQRPTPEQMMQMQTNQMVRALMLDDATAAKFTPIYEKYLKELRECRMMNFKPRARKDAAQGTEANTAKETPKPVM--TDAEIAKMLKDQFAQSRKMLDIREKYYNEFSKIL-SQKQIMKIYQQEK-SNMNKFRKEFDRRKG................................................ 168
3 -5.620PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali follow..  10  36IARVASLLSAGVLALVLLSCDGVGDFTNEDPTTANDPNPDLEFTTLQLGVSGSRFDMWRTNLIYTMPIVQHIAN-GNFNQYVGAWSASFFDTRYGGGPNGSNFLRTVTNAETLISELEGKPRQVNRLAATRIMRVLTFQRLTDVYGDV-FDAGKGALEGEFTPHRQDSIYMDLHDELRAAVDQFD------------------ASQPTFGGADLFFNGSIEQWKRFANSL 256
4 -5.610PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  10  1MKIERLFIYCLLAGTSLLASCNSEDMTDNPPLTFTAMQGEVVATPQTRVSDYDDTDGKHKSKWDGGEVIGVKIGTDGAVGSYTLDSDGKPTTSTSNIPAY----------TASQTVYGWYPNTADISLTGQD---NTGNKFPYVLKGVSSKQYSYKENVQLNLEHQ---LVKFRVKLNGDVPNLSDAKVFFY...................................... 188
5 -4.870HGC00024 gi|162813637|dbj|BABA01031072.1|2.0 TMP01508;  ali follow..  8LGMTKACLCALAVSLVTTGCSDLLDKEPPSAISDGSFWTGEGDAMLALTGCYRFQTSTLMASSNTVATNSNLRWYWGNAYTQIAKYNTFLENITDCPMEESKKEQWSAEVKCLRAYF----------------FLNLAFYYTDV---MPLKTLSVDEANSISQTPQTEVYSQVEKDLKTAIDLL.............................................. 202
6 -4.550HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  2MRRKNITWVWLLGAAFMVGCGKQVPENIIQPDRMENILYDYHLSISMGNNLSYSDNYQ---KEAYKNYVFEKHHITEAEFD--SSMVWYTRHTEELASLYKKLGERFRSEKKHMQELLAL.............................................................................................................. 116
7 -4.400PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  1....MRKLGFTLVAALAFSVSAFAN-------------ANDTINVAGKWDGTINKAKLTKYLQLSSQQNEQVASICDYFQEQMKVANS.............................................................................................................................................. 72
8 -4.170PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  1MKIKFLSFIASFFMVSFVITSC----------------------------LDDDNNIEYSPDATIHAFALDTAGLGSYKFT-IDQLSREIYNEDSL------------------------PVHADTII------DKILIKTLTTASGVVTMKDKSGNDSVININDSIDLREPLTIKVWSTEALAGISPNQTKEYTIKVNVHQHDPDSL-------------RWNHVGKM. 157
9 -4.130PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  19  1MK-RIVSMMVIFTLLLGGMTHVQAQTSKAAXXXXXXXXXXXXXXXRLAKDAVMGEEAFNNAMQAITNR.................................................................................................................................................................. 67
10 -4.020PB202086 Q8G498_BIFLO/2-200 PB202086; Pfam-B_202086;  ali follow..  13  102...........................VKDSKTVESL---GKELKASAPEYEGCVAENAQGLDAAAVKLNEQADWYETHEKSLSKAVRAVVESKAAKRLDDAKTNLTAKLDEASKLLADS.............................................................................................................. 191

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 8 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.