current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PB076697 gi|160881556|ref|YP_001560524.1| hypothetical protein Cphy_3432 [Clostridium phytofermentans ISDg]gi|160430222|gb|ABX43785.1| conserved hypothetical protein [Clostridium phytofermentans ISDg], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst NLITAILFILFIMAYFICLWVNSPNIIRDIKKSINKTLSVNVNQDLDEEDILDENIEQKPVSSTTSISAKLGTVFSKTESVINESIPGRLSLIDWNGLAQRILQKRMIPESNDNNTVYKMDNGQLTYTYPDIGVRIAHKNFTVLDKYLKSVGTKLLYVQAPYKVNRDNNQLPYGLKDYPNKNADKLLEGLNKLKIDYIDFREVFANNFLDYPSLFFNTDHHWTTEAAFFAYQYMLDYMEKNYEFQYNKQTYNGANYNQVTLKQSFIGSLANRVGKRYAGIDDFTFIYPNFKTKLTYMKFDANGSLYLVRNGTFEESVFYPERMDDPNTPLAYRDNCYLGGNPDLGRIINHKVQKGKILFVQDSYGKPIASFMALNFHEVDIIDLRYFTESYLMDFIKKETTPYDYVVILYNPSALKRSLast
1 -121.000PB076697 gi|160881556|ref|YP_001560524.1| hypothetical protein Cphy_3432 [Clostridium phytofermentans ISDg]gi|160430222|gb|ABX43785.1| conserved hypothetical protein [Clostridium phytofermentans ISDg]  ali  100  1NLITAILFILFIMAYFICLWVNSPNIIRDIKKSINKTLSVNVNQDLDEEDILDENIEQKPVSSTTSISAKLGTVFSKTESVINESIPGRLSLIDWNGLAQRILQKRMIPESNDNNTVYKMDNGQLTYTYPDIGVRIAHKNFTVLDKYLKSVGTKLLYVQAPYKVNRDNNQLPYGLKDYPNKNADKLLEGLNKLKIDYIDFREVFANNFLDYPSLFFNTDHHWTTEAAFFAYQYMLDYMEKNYEFQYNKQTYNGANYNQVTLKQSFIGSLANRVGKRYAGIDDFTFIYPNFKTKLTYMKFDANGSLYLVRNGTFEESVFYPERMDDPNTPLAYRDNCYLGGNPDLGRIINHKVQKGKILFVQDSYGKPIASFMALNFHEVDIIDLRYFTESYLMDFIKKETTPYDYVVILYNPSALKRS 418
2 -4.080PB011051 Q8A0P0_BACTN/1-227 PB011051; Pfam-B_11051;  ali follow..  1..MKTVFNIVLVLC------------AAALIYICYSSIMGPINFEKAKKEREQARLIDIRKAQQEYRSLHHGMYTEHFDTLI--DFVKNQKLVMKVGQLTDDQLESGLTEKKAMAIINKAKKTGKYDEVKKNGLENFKRDTMAVMDTIYPKGFNA-MKYIPYGNGA---EMNVKNDTAKSGAPVYLFEVKAPYETYLGGLDRQEIINLKDLNEKLGRYSGNW.................................................................................................................................................................................................... 227
3 -3.940PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  11  1...................MKIKFLSFIASFFMVSFVITSCLDDDNNIEYSPDATIHA---FALDTAGLGSYKF--TIDQYNEDSLPVHADTIIDKILIKTLTTASTMKDKSGNDSVININDSIDLREPLTIKVWSTEALAGISPNQTKEYTIKVNVHQHDPDSLRWNHVGKMQDEIIGEQKTKNLKVYQNSNYSNWTAAGTNTTGDLTANNKVYESTDVAWTISDK............................................................................................................................................................................................... 244
4 -3.840PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali follow..  17STLPLTPYTPAMPFLTRSRIARVASLLSAGVLALVLLSCDGVGDFGDTNEDPTTANDPNPDLEFTTLQL---GVSGSRFDMWRTNLIYTMPIVQHIANPGFYAGNFNQYVGAWSASFFVTNAETLISELEGKPRQVNRLAATRIMRVLTFQRLTDVYGDVPYFDAGKGALEGEFTPHYTRQDYMDLHDEL-RAAVDQFDASQPTFGGA----DLFFNGSEQWKRFA................................................................................................................................................................................................ 253
5 -3.780HGC00870 gi|163286116|dbj|BABD01024572.1|2.0 TMP01154;  ali follow..  27.........................................................................................................................................KDTLLKIEMALFPLHVRLRRVAKEDYVQPLGALAGV-FAFFSDNRLNQALAALRKSGAGTFPYKAILTP-----------TNQNWN-------ALQCFSEIRREHETIQKQLKGNKEQAEE................................................................................................................................................................ 149
6 -3.280PB007740 Q89YT2_BACTN/1-193 PB007740; Pfam-B_7740;  ali follow..  1...................MKTKFIYVVLMALFLGSQMTLSAQNEENKERKQRPTPEQMMQMQTNQMVRALMKFTPIYEKYLKELRECRMMNFKPRARKDAAQGTEANTAKETPKP-----------VMTDAEIAKMLKDQFAQSRKMLDIREKYY-ILSQKQIMKI........................................................................................................................................................................................................................................................... 148
7 -3.020PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali follow..  16.LLLFACPIIFASIMKKEFIGRTAKSLSLALAICIFGSVLPAWSQEIVAGELERCFLAMPESVLPIVTMEE-----------------RNDLCRRAGHLSGFTHTASLESSLGGTVTFLLNRNFIRIQTSTSDSSSVICVVTTVLHPVADSRIDFY---LKTDRFWQQPRIEDFFLPHTDRQSYAYQAIYASLTPSYMTVTETLAEEEKPLAAIFLSPEPRWQ................................................................................................................................................................................................... 255
8 -2.530PB009671 Q5LCM2_BACFN/1-111 PB009671; Pfam-B_9671;  ali follow..  13  40.................................................................................................................................................................KFTKITVKELPQVVKDYEGTIVKEAFVAEKENGKVYIIVTAIKEDQSTEEITVLLNEKGEP.................................................................................................................................................................................................... 106
9 -2.280PB009661 _Gut.Meta.Jp.0000785_ gi|162567239|dbj|BAAU01000237.1||2 (- 3549:4008~0 complete)  ali follow..  14  7..........................................................................................................................................ELLDEAVDFCRKRGLEFYAV---------NSNMPEEEADMSALRSRKVSADM------YID-------------------D---RNLGGLPDWGVIYEMVHNRWSYNRYLNEIHDFERSQK---VSWWKRLINK.................................................................................................................................................. 100
10 -2.160PB006933 gi|1881301|dbj|BAA19328.1| SIMILAR TO ORF13 OF ENTEROCOCCUS FAECALIS TRANSPOSON TN916. [Bacillus subtilis]  ali follow..  35......................AVTLWSCVGSLLFICLLAVLLSNDMKDETNKPTNDDKQKISVTAAENFLSGFINEYMNVKNDQESIEKRMQSLESYMVKQEGDRELKGYSLYNVKEGDKNSLFQYKVTYENLYPVEKEXXXXXXXXXXXXXX-MLLNIPKGDSFAVSAVPYFTQIYDLKGDIAFKGKEETRDEYAGEKKESIESFLQNFFEKYASEK....................................................................................................................................................................................................... 269

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.