current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00857 gi|162620543|dbj|BAAW01002606.1|2.0 TMP01139;, from HGM_OVER

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MLNFHSKKVMCIQQEIYARMIMYNFVQMITSHVVIVKKQRKHTYKANFSVATHMCRLFYREKTTSPNLETIIAKNLIPIRPDRHRERNLKVKTFHGFLYRVALast
1 -6.7505h1s_h mol:protein length:116 50S ribosomal protein 6, chloroplastic  ali model follow..  12  56........................................................................TAHHMKTRPKKTARWDIKRGPAVY...... 79
2 -5.3903fxh_A mol:protein length:135 Integron gene cassette protein HFX_CASS2  ali model follow..  13  88IENAFGRHANTVVMEDFALLLAINICLAILREINGE.................................................................. 128
3 -5.2903j5p_B mol:protein length:598 Transient receptor potential cation channel subfamily V member 1  ali model follow..  534..............VILTYILLLNMLIALMGETVNKAQESKNIWKLQRAITILDTEKSFLKCMRKAXXXXXXXXXXXX........................ 598
4 -5.2206all_A mol:protein length:324 Fe(3+)-citrate-binding protein yfmC  ali model follow..  107LEEISRLKPDLIITASFRGKAIKNELEQIAPTVMFDPSTSNNDHFAEMTETFKQIAKAVGKEEEGKKVLADMDKAFADAKA..................... 187
5 -5.2205wtl_A mol:protein length:261 OmpA family protein  ali model follow..  168......FQSAEVLNQIINVLKKYPNSRFRIEGHTDSTGKKAKNMILSQNRADAVKVYLIQGGIDAGRLESQGFGPEKPIASNKNKKGRELNRRVEINLIK.. 261
6 -5.2005bs1_A mol:protein length:123 CrRbcX-IIa  ali model follow..  6.DSFSGASPERKAAVALRSLFTFVAARVVLEQLQTTYNQQAYLDLMDFLGTPMKGDGGDEWMAAVMRKNHALALRLMEVR...................... 90
7 -5.1706c8f_A mol:protein length:675 Transient receptor potential cation channel, subfamily V, member 4  ali model follow..  548LEMINSAKYPAVFIILLTFVLLLNMLIALMGETVGQSKESKQIWKLQWATTILDIERSFPVCMR-KAFRSGEMVTVGKNLDGTPDRRRVDEVNWSHWNQNLG 658
8 -5.1505bs2_A mol:protein length:132 Ribulose bisphosphate carboxylase large chain,CrRbcX-IIa  ali model follow..  15.DSFSGASPERKAAVALRSLFTFVAARVVLEQLQTTYNQQAYLDLMDFLGTPMKGDGGDEWMAAVMRKNHALALRLMEVR...................... 99
9 -5.0801mv4_A mol:protein length:37 Tropomyosin 1 alpha chain  ali model follow..  21  3.....GKSIDDLEDELYAQKLKYKAISEELDHA..................................................................... 30
10 -4.9701du2_A mol:protein length:76 DNA POLYMERASE III  ali model follow..  5LAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRL............................................. 61

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.