current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00857 gi|162620543|dbj|BAAW01002606.1|2.0 TMP01139;, from HGM_OVER

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MLNFHSKKVMCIQQEIYARMIMYNFVQMITSHVVIVKKQRKHTYKANFSVATHMCRLFYREKTTSPNLETIIAKNLIPIRPDRHRERNLKVKTFHGFLYRVALast
1 -7.130PF01609.21; TRA2_ECOLX/112-294; Transposase DDE domain  ali follow..  13  160.GSLTLRDYDGQVAEAMALVRALN.............................................................................. 182
2 -6.410PF17471.2; K5BJG4_MYCHD/1-73; Gene product 63  ali follow..  11  3......RKVSPLRQQVLAALIKTRPTAWTQKKVDLRSENPRKPELIEVVHDGSELKYPLARNVSEASVEQAAKRWL.......................... 72
3 -6.390PF17119.5; F2SVE3_TRIRC/85-328; Mitochondrial protein up-regulated during meiosis  ali follow..  26LRTLSKQLPTILVNALPQEILSPSISLHLFPSTHPHLPTVK---RVPYRAALWTAPVAWGSVPIIGNVNLRIVSERVVPTGVANESDRNDSPGGEKLVVR.. 123
4 -6.360PF13751.6; B7GJ01_ANOFW/350-465; Transposase DDE domain  ali follow..  13  88LRFARYRGVQYVQIQVWITAMIQNLKKWI......................................................................... 116
5 -6.090PF17257.2; A0A061FFX6_THECC/35-96; Family of unknown function (DUF5323 topsan)  ali follow..  16  19........................................................................TKHHMKTRPRKTQAWDIRRKPTVY...... 42
6 -5.820PF10894.8; Q93GN7_SALTY/1-57; Protein of unknown function (DUF2689 topsan)  ali follow..  14  4IRNVISVPDESVQDDFVKYVIS-NCTTKIILSGRREYNFSRQEYNFSVT..................................................... 51
7 -5.770PF10326.9; Q18441_CAEEL/8-309; Serpentine type 7TM GPCR chemoreceptor Str  ali follow..  226.....SVPNKKLQKQFFKALVVQTIVPTFIFVCPAAFVLLCPFLNLEMNYQTGWIYAALSLYPPLDSLVLMIL-----VSEYRKAIK............... 302
8 -5.680PF16128.5; R5JQ03_9BACE/43-183; Domain of unknown function (DUF4840 topsan)  ali follow..  11  25.VAAKVDNDTIHFESFPVRDIILSIVKDEGLTDQIMEAIGDVSYKVGYEPTLTTAKDSINFILDPKPLSLSI.............................. 95
9 -5.570PF04693.12; Q5MPE9_9CREN/3-342; Archaeal putative transposase ISC1217  ali follow..  10  303MQDSSFLKRKRLQGYLLLFVMVVNAARDLVTSLNLKS................................................................. 339
10 -5.520PF05656.14; M4RPR7_9BIFI/58-197; Protein of unknown function (DUF805 topsan)  ali follow..  11  3..VFSGRAS---RSEFWWAYLYISILCAVFYYPVDTATKHHQNMLALVLDLLMFALVFPIITLTFRRL.................................. 65

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 5 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.