current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00164 gi|163636082|dbj|BABG01000191.1|4.0 TMP00833;, from HGM_OVER

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst MNDLIVDVKLWGESVGSLYWEKESNAALFDYERKFIRSGLDISPIIMPISQYRNTPYRFLENRTDCFKGLPGLFADSLPDTFGNQIINEWFASKGLSGEEITPLDRLCYVGKRGMGALEFEPSSPINGMNESSVLHIEELTELAKSVFTDRMAFQVQLRQEGRNILDILKVGTLast
1 -40.000d3dnua_ d.144.1.7 (A:) Multidrug tolerance (MDT) protein HipA N-terminal domain {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  15  2....KLVTWMNNQRVGELTKL-ANGAHTFKYAPEWLASRYARPSLSLPLQRGNI-----------TSDAVFNFFDNLLPDSPIV----RDRIVKRYHAKSRQPFDLLSEIGRDSVGAVTLIPEDETVTHPIMEKLTEARLEEVLTAYKADIPDFRISVAGAQEKTALLRIGND 165
2 -7.140d4v08a_ b.57.1.0 (A:) automated matches {Suid herpesvirus 1 [TaxId: 10345]}  ali model 3D-neighbors follow..  16  35.GPLPINIHRPRCDIGAVLAVVDDDRGPF---------GVVNCPQLGAVLARAVGPDFFGDMRLSDEERLLYLLSNYLP---SASLSSRRLAPGEAPDETLFAHVALCVIG-RRVGTIVVYDASPEAAVAPFRQLSARARSELLARAAESPDRERVWHMSEEALTRALLSTA. 195
3 -6.350d3fnca_ d.108.1.0 (A:) automated matches {Listeria innocua [TaxId: 272626]}  ali model 3D-neighbors follow..  11  1..............................................MDFHIRKATNSDAEAIQHVATTSWHHTYQDLIPSDVQDDFLKRFYNVETLHNRISATPFAVLEQADKVIGFANFIELEKGKSELAAFYLL-TELLEVGMTLFHVPLPMFVNVEKGNETAIHFYK... 132
4 -6.050d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  12  96MKEMLADLAKQKVALSYLAPFSYPFYRQYGYEQTFEQAEYTIKTEDWPRVKRV-PGTIKRVSWADGKEVIKDVYLENQRAHSGGVIRETWWLDYTLNRASKPNNQAIYYSSEGKAGYVIYRIAAGTFEIVEWNYLTFKALAGFIGSHSGSVQSFHWINGFAGKDLNDLMPT.. 269
5 -6.020d1p5dx2 c.84.1.1 (X:155-258) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  13  1.....................................................................................ILPRYFKQIRDDIAMAKPMKVVVDCGNGVAGVIAYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLAFDGDGDRVGVVTNTGT 102
6 -5.950d1nfpa_ c.1.16.2 (A:) Non-fluorescent flavoprotein (luxF, FP390) {Photobacterium leiognathi [TaxId: 553611]}  ali model 3D-neighbors follow..  11  65FVSLGKQIHVLATSPETVVKAAKYGMPLLHYQAAAAKFNVDIANVRHRLMLFVNVNDNPTQAKAELSIYLEDYLSYTQAETSIDEIINSNAAG-----NFDTCLHHVAEMAQGLNNKVDFLFCFESMKDQENKKSLMINFDKRVINYRKEHN..................... 226
7 -5.920d4q9wa1 d.22.1.0 (A:2-218) automated matches {Clavularia sp. [TaxId: 86521]}  ali model 3D-neighbors follow..  13  5.PDMKIKLKMEGNVNGYAFVIEGEGEGK-PYDGTNTINLEVKEGAPLPFSYDILTTAFXNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISLEEDSFIYEIYLKGENFPPNGPVMQKKTTGWDASTERMYVRDGVLKGDVKHKLLLEGGGYYRVDF..... 170
8 -5.920d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  10  104IQTALEEMRQDKQWISYLFPYNIPYYRRKGWEIMSDKLSFKIRDTQLPKTVPVPGMIERLAVDHPD---VFDVYARFARQNHGALIRSAFNWEEYWRFENEEERTAAVYYGANQLGVLFYWVADEVFHIKEMFYLNQEARNGLWNFITAHFSMVYWVKIYKNEPLAFLLED.. 275
9 -5.870d1u6za3 c.55.1.8 (A:136-312) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  83...................................................................................................................GTIKAAHEVLMEMGEKDGIITPERLEKLVKEVLRHRNFASLSLPGLSEERKTVFVPGL 140
10 -5.840d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]}  ali model 3D-neighbors follow..  11  93IQHTLQEISEQDIPISVLYPATQRLYRKAGYEQAGSSCVWEIPTDSIQIQHASLPLEPVVLKNNPIFHELYQQQAQLTHGYLDRH--PAIWQGLNRTLDTETLYSYLIGDKDKPQGYIIFTQERT----RDGSILRIRDWVTLSNPAVQS....................... 236

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24