current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: HGC00857 gi|162620543|dbj|BAAW01002606.1|2.0 TMP01139;, from HGM_OVER

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MLNFHSKKVMCIQQEIYARMIMYNFVQMITSHVVIVKKQRKHTYKANFSVATHMCRLFYREKTTSPNLETIIAKNLIPIRPDRHRERNLKVKTFHGFLYRVALast
1 -6.160d3bzca2 a.60.2.6 (A:564-636) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  13  9...........VHPE------TYPLVQRIAADTERDIRSLIGDSAFLKRLDPKKFTDETFGLPTVTDILKELDKPGRDPRPE.................... 73
2 -5.450d2idob_ a.237.1.1 (B:) Homolog of theta (HOT) {Bacteriophage P1 [TaxId: 10678]}  ali model 3D-neighbors follow..  10  5IAAKSQEERDKVNVDLAASGVAYKERLNIPVIAEQVAREQPENLRTYFMERLRHYRQ............................................. 61
3 -5.090d2hj2a3 d.130.1.1 (A:252-395) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]}  ali model 3D-neighbors follow..  14  31...FSGKDYTKVDRS--AAYAARWVAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERELLEIVKKNFDLRPG.................... 107
4 -4.520d2wdta_ d.3.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}  ali model 3D-neighbors follow..  12  30IYGFNNDLLDMIPQPVQAVIFLYPVNDNIVSENNTNDKHNLKENFDNVWFIKQYIPNSCGTIALLHLYGN--LRNKFELDKDSVLDDFFNKVNEMSAEKR.. 127
5 -4.440d1a8da2 b.42.4.2 (A:248-452) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}  ali model 3D-neighbors follow..  11  3...........FLRDFWGNPLRYDLIPVASSSKDVQLKNITDYMYLTNAPSYTNGKLNIYYRRLYNGLKFIIKR----YTPNNEIDSFVKSGDFIK...... 87
6 -4.430d1ikpa3 f.1.5.1 (A:252-394) Exotoxin A, middle domain {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  18LETFRHRQPRGAEQLEQCGYPVQRLVALYLAA------------RLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAESER.......... 98
7 -4.400d1dt9a3 d.91.1.1 (A:5-142) N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20LEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRL........................................... 78
8 -4.400d4ogqb_ f.32.1.1 (B:) automated matches {Nostoc sp. [TaxId: 103690]}  ali model 3D-neighbors follow..  11  69......ATPLEILPEWY--YPVFQILRSLPNKL..................................................................... 94
9 -4.340d4af1a1 d.91.1.0 (A:7-144) automated matches {Halobacterium salinarum [TaxId: 478009]}  ali model 3D-neighbors follow..  18LKDYEGSGTQLVTIYIPPDKQISDVVAHVTQEHSEASNIKSKQTRTNVQDALTSIKDRL........................................... 76
10 -4.200d1jjga_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Myxoma virus, m156r [TaxId: 10273]}  ali model 3D-neighbors follow..  30  1...........................................................................MTVIKPS-SRPRPRKNKNIKVNTYRTS 26

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.